KEGG   Homo sapiens (human): 7728Help
Entry
7728              CDS       T01001                                 

Gene name
ZNF175, OTK18
Definition
(RefSeq) zinc finger protein 175
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    7728 (ZNF175)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7728 (ZNF175)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    7728 (ZNF175)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB Zn-ribbon_8 zf_UBZ zf-C2H2_6 ADK_lid zinc_ribbon_15 zf-C2H2_jaz zf-LYAR DUF3268 zf-met
Motif
Other DBs
NCBI-GeneID: 7728
NCBI-ProteinID: NP_009078
OMIM: 601139
HGNC: 12964
Ensembl: ENSG00000105497
Vega: OTTHUMG00000167771
Pharos: Q9Y473(Tbio)
UniProt: Q9Y473
LinkDB All DBs
Position
19q13.41
AA seq 711 aa AA seqDB search
MPADVNLSQKPQVLGPEKQDGSCEASVSFEDVTVDFSREEWQQLDPAQRCLYRDVMLELY
SHLFAVGYHIPNPEVIFRMLKEKEPRVEEAEVSHQRCQEREFGLEIPQKEISKKASFQKD
MVGEFTRDGSWCSILEELRLDADRTKKDEQNQIQPMSHSAFFNKKTLNTESNCEYKDPGK
MIRTRPHLASSQKQPQKCCLFTESLKLNLEVNGQNESNDTEQLDDVVGSGQLFSHSSSDA
CSKNIHTGETFCKGNQCRKVCGHKQSLKQHQIHTQKKPDGCSECGGSFTQKSHLFAQQRI
HSVGNLHECGKCGKAFMPQLKLSVYLTDHTGDIPCICKECGKVFIQRSELLTHQKTHTRK
KPYKCHDCGKAFFQMLSLFRHQRTHSREKLYECSECGKGFSQNSTLIIHQKIHTGERQYA
CSECGKAFTQKSTLSLHQRIHSGQKSYVCIECGQAFIQKAHLIVHQRSHTGEKPYQCHNC
GKSFISKSQLDIHHRIHTGEKPYECSDCGKTFTQKSHLNIHQKIHTGERHHVCSECGKAF
NQKSILSMHQRIHTGEKPYKCSECGKAFTSKSQFKEHQRIHTGEKPYVCTECGKAFNGRS
NFHKHQITHTRERPFVCYKCGKAFVQKSELITHQRTHMGEKPYECLDCGKSFSKKPQLKV
HQRIHTGERPYVCSECGKAFNNRSNFNKHQTTHTRDKSYKCSYSVKGFTKQ
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgatgtgaatttatcccagaagcctcaggtcctgggtccagagaagcaggat
ggatcttgcgaggcatcagtgtcatttgaggacgtgaccgtggacttcagcagggaggag
tggcagcaactggaccctgcccagagatgcctgtaccgggatgtgatgctggagctctat
agccatctcttcgcagtggggtatcacattcccaacccagaggtcatcttcagaatgcta
aaagaaaaggagccgcgtgtggaggaggctgaagtctcacatcagaggtgtcaagaaagg
gagtttgggcttgaaatcccacaaaaggagatttctaagaaagcttcatttcaaaaggat
atggtaggtgagttcacaagagatggttcatggtgttccattttagaagaactgaggctg
gatgctgaccgcacaaagaaagatgagcaaaatcaaattcaacccatgagtcacagtgct
ttcttcaacaagaaaacattgaacacagaaagcaattgtgaatataaggaccctgggaaa
atgattcgcacgaggccccaccttgcttcttcacagaaacaacctcagaaatgttgctta
tttacagaaagtttgaagctgaacctagaagtgaacggtcagaatgaaagcaatgacaca
gaacagcttgatgacgttgttgggtctggtcagctattcagccatagctcttctgatgcc
tgcagcaagaatattcatacaggagagacattttgcaaaggtaaccagtgtagaaaagtc
tgtggccataaacagtcactcaagcaacatcaaattcatactcagaagaaaccagatgga
tgttctgaatgtggggggagcttcacccagaagtcacacctctttgcccaacagagaatt
catagtgtaggaaacctccatgaatgtggcaaatgtggaaaagccttcatgccacaacta
aaactcagtgtatatctgacagatcatacaggtgatataccctgtatatgcaaggaatgt
gggaaggtctttattcagagatcagaattgcttacgcaccagaaaacacacactagaaag
aagccctataaatgccatgactgtggaaaagcctttttccagatgttatctctcttcaga
catcagagaactcacagtagagaaaaactctatgaatgcagtgaatgtggcaaaggcttc
tcccaaaactcaaccctcattatacatcagaaaattcatactggtgagagacagtatgca
tgcagtgaatgtgggaaagcctttacccagaagtcaacactcagcttgcaccagagaatc
cactcagggcagaagtcctatgtgtgtatcgaatgcgggcaggccttcatccagaaggca
cacctgattgtccatcaaagaagccacacaggagaaaaaccttatcagtgccacaactgt
gggaaatccttcatttccaagtcacagcttgatatacatcatcgaattcatacaggggag
aaaccttatgaatgcagtgactgtggaaaaaccttcacccaaaagtcacacctgaatata
caccagaaaattcatactggagaaagacaccatgtatgcagtgaatgcgggaaagccttc
aaccagaagtcaatactcagcatgcatcagagaattcacaccggagagaagccttacaaa
tgcagtgaatgtgggaaagccttcacttctaagtctcaattcaaagagcatcagcgaatt
cacacgggtgagaaaccctatgtgtgcactgaatgtgggaaggccttcaacggcaggtca
aatttccataaacatcaaataactcacactagagagaggccttttgtctgttacaaatgt
gggaaggcttttgtccagaaatcagagttgattacccatcaaagaactcacatgggagag
aaaccctatgaatgccttgactgtgggaaatcgttcagtaagaaaccacaactcaaggtg
catcagcgaattcacacgggagaaagaccttatgtgtgttctgaatgtggaaaggccttc
aacaacaggtcaaacttcaataaacaccaaacaactcataccagagacaaatcttacaaa
tgcagttattctgtgaaaggctttaccaagcaatga

DBGET integrated database retrieval system