KEGG   Homo sapiens (human): 7791Help
Entry
7791              CDS       T01001                                 

Gene name
ZYX, ESP-2, HED-2
Definition
(RefSeq) zyxin
  KO
K06273  zyxin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7791 (ZYX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM zf-dskA_traR zf_C2H2_13 DUF2757
Motif
Other DBs
NCBI-GeneID: 7791
NCBI-ProteinID: NP_001010972
OMIM: 602002
HGNC: 13200
Ensembl: ENSG00000159840
Vega: OTTHUMG00000023822
Pharos: Q15942(Tbio)
UniProt: Q15942 Q96AF9
LinkDB All DBs
Position
7q34
AA seq 572 aa AA seqDB search
MAAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRV
GEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPP
PEEEGGPEAPIPPPPQPREKVSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATP
FSSKSSTKPAAGGTAPLPPWKSPSSSQPLPQVPAPAQSQTQFHVQPQPQPKPQVQLHVQS
QTQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPE
ALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELE
QLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQ
GQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGT
SFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDC
GKPLSIEADDNGCFPLDGHVLCRKCHTARAQT
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcggccccccgcccgtctcccgcgatctccgtttcggtctcggctccggctttttac
gccccgcagaagaagttcggccctgtggtggccccaaagcccaaagtgaatcccttccgg
cccggggacagcgagcctcccccggcacccggggcccagcgcgcacagatgggccgggtg
ggcgagattcccccgccgcccccggaagactttcccctgcctccacctccccttgctggg
gatggcgacgatgcagagggtgctctgggaggtgccttcccgccgccccctcccccgatc
gaggaatcatttccccctgcgcctctggaggaggagatcttcccttccccgccgcctcct
ccggaggaggagggagggcctgaggcccccataccgcccccaccacagcccagggagaag
gtgagcagtattgatttggagatcgactctctgtcctcactgctggatgacatgaccaag
aatgatcctttcaaagcccgggtgtcatctggatatgtgcccccaccagtggccactcca
ttcagttccaagtccagtaccaagcctgcagccgggggcacagcacccctgcctccttgg
aagtccccttccagctcccagcctctgccccaggttccggctccggctcagagccagaca
cagttccatgttcagccccagccccagcccaagcctcaggtccaactccatgtccagtcc
cagacccagcctgtgtctttggctaacacccagccccgagggcccccagcctcatctccg
gctccagcccctaagttttctccagtgactcctaagtttactcctgtggcttccaagttc
agtcctggagccccaggtggatctgggtcacaaccaaatcaaaaattggggcaccccgaa
gctctttctgctggcacaggctcccctcaacctcccagcttcacctatgcccagcagagg
gagaagccccgagtgcaggagaagcagcaccccgtgcccccaccggctcagaaccaaaac
caggtgcgctcccctggggccccagggcccctgactctgaaggaggtggaggagctggag
cagctgacccagcagctaatgcaggacatggagcatcctcagaggcagaatgtggctgtc
aacgaactctgcggccgatgccatcaacccctggcccgggcgcagccagccgtccgcgct
ctagggcagctgttccacatcgcctgcttcacctgccaccagtgtgcgcagcagctccag
ggccagcagttctacagtctggagggggcgccgtactgcgagggctgttacactgacacc
ctggagaagtgtaacacctgcggggagcccatcactgaccgcatgctgagggccacgggc
aaggcctatcacccgcactgcttcacctgtgtggtctgcgcccgccccctggagggcacc
tccttcatcgtggaccaggccaaccggccccactgtgtccccgactaccacaagcagtac
gccccgaggtgctccgtctgctctgagcccatcatgcctgagcctggccgagatgagact
gtgcgagtggtcgccctggacaagaacttccacatgaagtgttacaagtgtgaggactgc
gggaagcccctgtcgattgaggcagatgacaatggctgcttccccctggacggtcacgtg
ctctgtcggaagtgccacactgctagagcccagacctga

DBGET integrated database retrieval system