KEGG   Homo sapiens (human): 7867Help
Entry
7867              CDS       T01001                                 

Gene name
MAPKAPK3, 3PK, MAPKAP-K3, MAPKAP3, MAPKAPK-3, MDPT3, MK-3, MK3
Definition
(RefSeq) MAPK activated protein kinase 3
  KO
K04444  mitogen-activated protein kinase-activated protein kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04370  VEGF signaling pathway
Disease
H01890  Pattern dystrophies of the retinal pigment epithelium
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7867 (MAPKAPK3)
   04370 VEGF signaling pathway
    7867 (MAPKAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    7867 (MAPKAPK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     7867 (MAPKAPK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   7867 (MAPKAPK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 7867
NCBI-ProteinID: NP_001230854
OMIM: 602130
HGNC: 6888
Ensembl: ENSG00000114738
Vega: OTTHUMG00000156850
Pharos: Q16644(Tbio)
UniProt: Q16644 A0A024R2W7
LinkDB All DBs
Structure
PDB: 

Position
3p21.2
AA seq 382 aa AA seqDB search
MDGETAEEQGGPVPPPVAPGGPGLGGAPGGRREPKKYAVTDDYQLSKQVLGLGVNGKVLE
CFHRRTGQKCALKLLYDSPKARQEVDHHWQASGGPHIVCILDVYENMHHGKRCLLIIMEC
MEGGELFSRIQERGDQAFTEREAAEIMRDIGTAIQFLHSHNIAHRDVKPENLLYTSKEKD
AVLKLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGFP
PFYSNTGQAISPGMKRRIRLGQYGFPNPEWSEVSEDAKQLIRLLLKTDPTERLTITQFMN
HPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNR
LLNKRRKKQAGSSSASQGCNNQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggatggtgaaacagcagaggagcaggggggccctgtgcccccgccagttgcacccggc
ggacccggcttgggcggtgctccgggggggcggcgggagcccaagaagtacgcagtgacc
gacgactaccagttgtccaagcaggtgctgggcctgggtgtgaacggcaaagtgctggag
tgcttccatcggcgcactggacagaagtgtgccctgaagctcctgtatgacagccccaag
gcccggcaggaggtagaccatcactggcaggcttctggcggcccccatattgtctgcatc
ctggatgtgtatgagaacatgcaccatggcaagcgctgtctcctcatcatcatggaatgc
atggaaggtggtgagttgttcagcaggattcaggagcgtggcgaccaggctttcactgag
agagaagctgcagagataatgcgggatattggcactgccatccagtttctgcacagccat
aacattgcccaccgagatgtcaagcctgaaaacctactctacacatctaaggagaaagac
gcagtgcttaagctcaccgattttggctttgctaaggagaccacccaaaatgccctgcag
acaccctgctatactccctattatgtggcccctgaggtcctgggtccagagaagtatgac
aagtcatgtgacatgtggtccctgggtgtcatcatgtacatcctcctttgtggcttccca
cccttctactccaacacgggccaggccatctccccggggatgaagaggaggattcgcctg
ggccagtacggcttccccaatcctgagtggtcagaagtctctgaggatgccaagcagctg
atccgcctcctgttgaagacagaccccacagagaggctgaccatcactcagttcatgaac
cacccctggatcaaccaatcgatggtagtgccacagaccccactccacacggcccgagtg
ctgcaggaggacaaagaccactgggacgaagtcaaggaggagatgaccagtgccttggcc
actatgcgggtagactacgaccaggtgaagatcaaggacctgaagacctctaacaaccgg
ctcctcaacaagaggagaaaaaagcaggcaggcagctcctctgcctcacagggctgcaac
aaccagtag

DBGET integrated database retrieval system