KEGG   Homo sapiens (human): 7879Help
Entry
7879              CDS       T01001                                 

Gene name
RAB7A, PRO2706, RAB7
Definition
(RefSeq) RAB7A, member RAS oncogene family
  KO
K07897  Ras-related protein Rab-7A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04144  Endocytosis
hsa04145  Phagosome
hsa05132  Salmonella infection
hsa05146  Amoebiasis
hsa05152  Tuberculosis
Disease
H00264  Charcot-Marie-Tooth disease (CMT)
H00265  Hereditary sensory and autonomic neuropathy (HSAN)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    7879 (RAB7A)
   04145 Phagosome
    7879 (RAB7A)
   04140 Autophagy - animal
    7879 (RAB7A)
   04137 Mitophagy - animal
    7879 (RAB7A)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    7879 (RAB7A)
   05152 Tuberculosis
    7879 (RAB7A)
   05146 Amoebiasis
    7879 (RAB7A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    7879 (RAB7A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7879 (RAB7A)
  Exosomal proteins of other body fluids (saliva and urine)
   7879 (RAB7A)
  Exosomal proteins of colorectal cancer cells
   7879 (RAB7A)
  Exosomal proteins of bladder cancer cells
   7879 (RAB7A)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    7879 (RAB7A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU Septin cobW ATP_bind_1 AAA_22 PduV-EutP SRPRB AAA_24 AAA_16 NTPase_1 AAA_5 G-alpha ATPase_2 NACHT TniB
Motif
Other DBs
NCBI-GeneID: 7879
NCBI-ProteinID: NP_004628
OMIM: 602298
HGNC: 9788
Ensembl: ENSG00000075785
Vega: OTTHUMG00000159812
Pharos: P51149(Tbio)
UniProt: P51149 A0A158RFU6
LinkDB All DBs
Structure
PDB: 

Position
3q21.3
AA seq 207 aa AA seqDB search
MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ
IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF
VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV
ELYNEFPEPIKLDKNDRAKASAESCSC
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagtcggg
aagacatcactcatgaaccagtatgtgaataagaaattcagcaatcagtacaaagccaca
ataggagctgactttctgaccaaggaggtgatggtggatgacaggctagtcacaatgcag
atatgggacacagcaggacaggaacggttccagtctctcggtgtggccttctacagaggt
gcagactgctgcgttctggtatttgatgtgactgcccccaacacattcaaaaccctagat
agctggagagatgagtttctcatccaggccagtccccgagatcctgaaaacttcccattt
gttgtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag
gcctggtgctacagcaaaaacaacattccctactttgagaccagtgccaaggaggccatc
aacgtggagcaggcgttccagacgattgcacggaatgcacttaagcaggaaacggaggtg
gagctgtacaacgaatttcctgaacctatcaaactggacaagaatgaccgggccaaggcc
tcggcagaaagctgcagttgctga

DBGET integrated database retrieval system