KEGG   Homo sapiens (human): 79191Help
Entry
79191             CDS       T01001                                 

Gene name
IRX3, IRX-1, IRXB1
Definition
(RefSeq) iroquois homeobox 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Homeobox_KN Homeodomain BUD22 MRP-S32
Motif
Other DBs
NCBI-GeneID: 79191
NCBI-ProteinID: NP_077312
OMIM: 612985
HGNC: 14360
Ensembl: ENSG00000177508
Vega: OTTHUMG00000133200
Pharos: P78415(Tbio)
UniProt: P78415
LinkDB All DBs
Position
16q12.2
AA seq 501 aa AA seqDB search
MSFPQLGYQYIRPLYPSERPGAAGGSGGSAGARGGLGAGASELNASGSLSNVLSSVYGAP
YAAAAAAAAAQGYGAFLPYAAELPIFPQLGAQYELKDSPGVQHPAAAAAFPHPHPAFYPY
GQYQFGDPSRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFAN
ARRRLKKENKMTWAPRSRTDEEGNAYGSEREEEDEEEDEEDGKRELELEEEELGGEEEDT
GGEGLADDDEDEEIDLENLDGAATEPELSLAGAARRDGDLGLGPISDSKNSDSEDSSEGL
EDRPLPVLSLAPAPPPVAVASPSLPSPPVSLDPCAPAPAPASALQKPKIWSLAETATSPD
NPRRSPPGAGGSPPGAAVAPSALQLSPAAAAAAAHRLVSAPLGKFPAWTNRPFPGPPPGP
RLHPLSLLGSAPPHLLGLPGAAGHPAAAAAFARPAEPEGGTDRCSALEVEKKLLKTAFQP
VPRRPQNHLDAALVLSALSSS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcccccagctgggataccaatacatccgcccgctttacccgtccgagcgcccg
ggggccgctggcggcagcggcggcagcgcgggggcccggggcggcctgggtgccggagcc
tcggagctgaacgcctcggggtccctgtccaacgtgctctcgtccgtgtacggggcgccc
tacgccgcggccgctgcggccgccgccgcccaaggctacggcgccttcctgccctacgcc
gcggagctgcccatcttcccgcagctgggcgcgcagtatgagctgaaggacagccccggg
gtgcagcatccggccgcggctgccgcgtttccgcacccgcaccccgccttctacccgtat
ggccagtaccagttcggggacccgtcccgtcccaagaacgccaccagggagagcaccagc
acgctgaaggcctggctcaacgagcaccgcaagaacccctaccccaccaagggcgagaag
atcatgctggccatcatcaccaagatgaccctcacccaggtgtccacctggttcgccaac
gcgcgccggcgcctcaagaaggagaataagatgacttgggcgcctcgcagccgcactgac
gaggagggaaacgcttatgggagcgagcgcgaggaggaagacgaagaggaggacgaggag
gacggcaaacgcgagctagagctggaggaggaggagctcgggggggaggaggaggacacg
gggggcgagggcctggctgacgacgacgaggacgaggagatcgatttggagaacttagac
ggcgcggccaccgagcctgagctgtccctggctggggcggcgcgcagggatggcgaccta
ggcctgggacccatttcggactccaaaaatagcgactcggaagatagctctgagggctta
gaggaccggccactaccggtcctgagtctggctccagcgccaccaccagtggccgtggcc
tcgccgtctctgccgtcgccccccgtgagcctggacccctgcgctcccgcaccagccccc
gcctccgccctgcagaagcccaagatctggtccctcgcggagactgccacaagcccggac
aacccgcgccgctcgcctcccggcgcgggggggtctccaccgggggcagcggtcgcgcct
tccgccctgcagctctctccggccgccgccgccgccgccgctcacagactggtctcagcg
ccgctgggcaagttcccggcttggaccaaccggccgtttccaggcccaccgcccggcccc
cgcctgcacccgctctccctgctgggctctgcccctccgcacctgctgggacttcccgga
gccgcgggccacccggctgccgccgccgccttcgctcggccagcggagcccgaaggcgga
acagatcgctgtagtgccttggaagtggagaaaaagttactcaagacagctttccagccc
gtgcccaggcggccccagaaccatctggacgccgccctggtcttatcggctctctcctca
tcctag

DBGET integrated database retrieval system