KEGG   Homo sapiens (human): 79444Help
Entry
79444             CDS       T01001                                 

Gene name
BIRC7, KIAP, LIVIN, ML-IAP, MLIAP, RNF50
Definition
(RefSeq) baculoviral IAP repeat containing 7
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04215  Apoptosis - multiple species
hsa05145  Toxoplasmosis
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    79444 (BIRC7)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    79444 (BIRC7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    79444 (BIRC7)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    79444 (BIRC7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    79444 (BIRC7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    79444 (BIRC7)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    79444 (BIRC7)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I32: IAP family
   79444 (BIRC7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    79444 (BIRC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4 zf-RING_2 zf-RING_UBOX DUF2039 zf-C3HC4_2 ArfGap
Motif
Other DBs
NCBI-GeneID: 79444
NCBI-ProteinID: NP_647478
OMIM: 605737
HGNC: 13702
Ensembl: ENSG00000101197
Vega: OTTHUMG00000032957
Pharos: Q96CA5(Tbio)
UniProt: Q96CA5
LinkDB All DBs
Structure
PDB: 

Position
20q13.33
AA seq 298 aa AA seqDB search
MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLR
PLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQD
KVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPW
EEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVE
AQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgggacctaaagacagtgccaagtgcctgcaccgtggaccacagccgagccactgggca
gccggtgatggtcccacgcaggagcgctgtggaccccgctctctgggcagccctgtccta
ggcctggacacctgcagagcctgggaccacgtggatgggcagatcctgggccagctgcgg
cccctgacagaggaggaagaggaggagggcgccggggccaccttgtccagggggcctgcc
ttccccggcatgggctctgaggagttgcgtctggcctccttctatgactggccgctgact
gctgaggtgccacccgagctgctggctgctgccggcttcttccacacaggccatcaggac
aaggtgaggtgcttcttctgctatgggggcctgcagagctggaagcgcggggacgacccc
tggacggagcatgccaagtggttccccagctgtcagttcctgctccggtcaaaaggaaga
gactttgtccacagtgtgcaggagactcactcccagctgctgggctcctgggacccgtgg
gaagaaccggaagacgcagcccctgtggccccctccgtccctgcctctgggtaccctgag
ctgcccacacccaggagagaggtccagtctgaaagtgcccaggagccaggaggggtcagt
ccagccgaggcccagagggcgtggtgggttcttgagcccccaggagccagggatgtggag
gcgcagctgcggcggctgcaggaggagaggacgtgcaaggtgtgcctggaccgcgccgtg
tccatcgtctttgtgccgtgcggccacctggtctgtgctgagtgtgcccccggcctgcag
ctgtgccccatctgcagagcccccgtccgcagccgcgtgcgcaccttcctgtcctag

DBGET integrated database retrieval system