KEGG   Homo sapiens (human): 796Help
Entry
796               CDS       T01001                                 

Gene name
CALCA, CALC1, CGRP, CGRP-I, CGRP1, CT, KC, PCT
Definition
(RefSeq) calcitonin related polypeptide alpha
  KO
K12332  calcitonin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
Drug target
Eptinezumab: D11303
Fremanezumab: D11055
Galcanezumab: D10936
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    796 (CALCA)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    796 (CALCA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calc_CGRP_IAPP
Motif
Other DBs
NCBI-GeneID: 796
NCBI-ProteinID: NP_001029124
OMIM: 114130
HGNC: 1437
Ensembl: ENSG00000110680
Vega: OTTHUMG00000159731
Pharos: P01258(Tbio)
CPD: C15876 C16125
UniProt: P01258
LinkDB All DBs
Position
11p15.2
AA seq 141 aa AA seqDB search
MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ
MKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKR
DMSSDLERDHRPHVSMPQNAN
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgggcttccaaaagttctcccccttcctggctctcagcatcttggtcctgttgcaggca
ggcagcctccatgcagcaccattcaggtctgccctggagagcagcccagcagacccggcc
acgctcagtgaggacgaagcgcgcctcctgctggctgcactggtgcaggactatgtgcag
atgaaggccagtgagctggagcaggagcaagagagagagggctccagcctggacagcccc
agatctaagcggtgcggtaatctgagtacttgcatgctgggcacatacacgcaggacttc
aacaagtttcacacgttcccccaaactgcaattggggttggagcacctggaaagaaaagg
gatatgtccagcgacttggagagagaccatcgccctcatgttagcatgccccagaatgcc
aactaa

DBGET integrated database retrieval system