KEGG   Homo sapiens (human): 796
Entry
796               CDS       T01001                                 

Gene name
CALCA, CALC1, CGRP, CGRP-I, CGRP-alpha, CGRP1, CT, KC, PCT
Definition
(RefSeq) calcitonin related polypeptide alpha
  KO
K12332  calcitonin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
Drug target
Eptinezumab: D11303<US>
Fremanezumab: D11055<US>
Galcanezumab: D10936<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    796 (CALCA)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    796 (CALCA)
SSDB
Motif
Pfam: Calc_CGRP_IAPP
Other DBs
NCBI-GeneID: 796
NCBI-ProteinID: NP_001029124
OMIM: 114130
HGNC: 1437
Ensembl: ENSG00000110680
Vega: OTTHUMG00000159731
Pharos: P01258(Tbio)
CPD: C15876 C16125
UniProt: P01258
LinkDB
Position
11p15.2
AA seq 141 aa
MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ
MKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKR
DMSSDLERDHRPHVSMPQNAN
NT seq 426 nt   +upstreamnt  +downstreamnt
atgggcttccaaaagttctcccccttcctggctctcagcatcttggtcctgttgcaggca
ggcagcctccatgcagcaccattcaggtctgccctggagagcagcccagcagacccggcc
acgctcagtgaggacgaagcgcgcctcctgctggctgcactggtgcaggactatgtgcag
atgaaggccagtgagctggagcaggagcaagagagagagggctccagcctggacagcccc
agatctaagcggtgcggtaatctgagtacttgcatgctgggcacatacacgcaggacttc
aacaagtttcacacgttcccccaaactgcaattggggttggagcacctggaaagaaaagg
gatatgtccagcgacttggagagagaccatcgccctcatgttagcatgccccagaatgcc
aactaa

KEGG   Homo sapiens (human): 797
Entry
797               CDS       T01001                                 

Gene name
CALCB, CALC2, CGRP-II, CGRP2
Definition
(RefSeq) calcitonin related polypeptide beta
  KO
K12332  calcitonin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    797 (CALCB)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    797 (CALCB)
SSDB
Motif
Pfam: Calc_CGRP_IAPP
Other DBs
NCBI-GeneID: 797
NCBI-ProteinID: NP_000719
OMIM: 114160
HGNC: 1438
Ensembl: ENSG00000175868
Vega: OTTHUMG00000164629
Pharos: P10092(Tbio)
CPD: C16126
UniProt: P10092
LinkDB
Position
11p15.2
AA seq 127 aa
MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQM
KASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGR
RRRDLQA
NT seq 384 nt   +upstreamnt  +downstreamnt
atgggtttccggaagttctcccccttcctggctctcagtatcttggtcctgtaccaggcg
ggcagcctccaggcggcgccattcaggtctgccctggagagcagcccagacccggccaca
ctcagtaaagaggacgcgcgcctcctgctggctgcactggtgcaggactatgtgcagatg
aaggccagtgagctgaagcaggagcaggagacacagggctccagctccgctgcccagaag
agagcctgcaacactgccacctgtgtgactcatcggctggcaggcttgctgagcagatca
gggggcatggtgaagagcaacttcgtgcccaccaatgtgggttccaaagcctttggcagg
cgccgcagggaccttcaagcctga

DBGET integrated database retrieval system