KEGG   Homo sapiens (human): 79778
Entry
79778             CDS       T01001                                 

Gene name
MICALL2, JRAB, MICAL-L2
Definition
(RefSeq) MICAL like 2
  KO
K21068  MICAL-like protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    79778 (MICALL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    79778 (MICALL2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    79778 (MICALL2)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    79778 (MICALL2)
SSDB
Motif
Pfam: DUF3585 CH CAMSAP_CH LIM SLATT_5
Other DBs
NCBI-GeneID: 79778
NCBI-ProteinID: NP_891554
HGNC: 29672
Ensembl: ENSG00000164877
Vega: OTTHUMG00000119021
Pharos: Q8IY33(Tbio)
UniProt: Q8IY33 Q6UWK3
LinkDB
Position
7p22.3
AA seq 904 aa
MAAIRALQQWCRQQCEGYRDVNICNMTTSFRDGLAFCAILHRHRPDLINFSALKKENIYE
NNKLAFRVAEEHLGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRSPIGGMAGVKR
ASEDSEEEPSGKKAPVQAAKLPSPAPARKPPLSPAQTNPVVQRRNEGAGGPPPKTDQALA
GSLVSSTCGVCGKHVHLVQRHLADGRLYHRSCFRCKQCSCTLHSGAYKATGEPGTFVCTS
HLPAAASASPKLTGLVPRQPGAMGVDSRTSCSPQKAQEANKARPSAWEPAAGNSPARASV
PAAPNPAATSATSVHVRSPARPSESRLAPTPTEGKVRPRVTNSSPMGWSSAAPCTAAAAS
HPAVPPSAPDPRPATPQGGGAPRVAAPQTTLSSSSTSAATVDPPAWTPSASRTQQARNKF
FQTSAVPPGTSLSGRGPTPSLVLSKDSSKEQARNFLKQALSALEEAGAPAPGRPSPATAA
VPSSQPKTEAPQASPLAKPLQSSSPRVLGLPSRMEPPAPLSTSSTSQASALPPAGRRNLA
ESSGVGRVGAGSRPKPEAPMAKGKSTTLTQDMSTSLQEGQEDGPAGWRANLKPVDRRSPA
ERTLKPKEPRALAEPRAGEAPRKVSGSFAGSVHITLTPVRPDRTPRPASPGPSLPARSPS
PPRRRRLAVPASLDVCDNWLRPEPPGQEARVQSWKEEEKKPHLQGKPGRPLSPANVPALP
GETVTSPVRLHPDYLSPEEIQRQLQDIERRLDALELRGVELEKRLRAAEGDDAEDSLMVD
WFWLIHEKQLLLRQESELMYKSKAQRLEEQQLDIEGELRRLMAKPEALKSLQERRREQEL
LEQYVSTVNDRSDIVDSLDEDRLREQEEDQMLRDMIEKLGLQRKKSKFRLSKIWSPKSKS
SPSQ
NT seq 2715 nt   +upstreamnt  +downstreamnt
atggcggccatcagggcgctgcaacagtggtgccggcagcagtgcgagggctaccgcgac
gtgaatatctgcaacatgaccacgtcgttccgcgacggcctggctttctgcgccatcctg
caccgccaccggcccgacctcataaacttcagtgctctcaagaaggaaaatatttatgaa
aacaataaactggccttccgcgtggccgaggagcacttgggcatcccagccttgctggat
gccgaggacatggtggccttgaaggtgcctgaccggctgagcatcttgacctacgtgtcc
cagtattacaactacttccacggccgctcccccattgggggcatggcaggcgtgaagagg
gcctcggaggactctgaggaggagccgtcagggaagaaggctccagtccaggcggccaag
ctgccctcgcccgccccagcccggaagcctccactatctccagcccagacaaaccctgtg
gtccagaggaggaatgagggtgcagggggcccgccccccaagactgaccaggcattggcg
ggcagcttggtcagcagcacctgcggggtctgcggcaagcacgtgcacctggtacagcgg
cacctggccgacgggaggctttaccaccggagctgcttcaggtgtaagcagtgctcctgc
acgctgcactcgggggcctacaaggccacaggagagccgggcaccttcgtctgcaccagc
cacctccccgcagccgcctctgcaagccccaagttgacgggtctggtcccccgacagcca
ggggccatgggtgtggattccaggacctcctgttccccacagaaggcccaggaggcaaac
aaggccagaccgtcggcctgggagcctgctgcgggcaactcgcctgccagggcttccgtt
ccagctgcacccaaccctgcagccaccagcgccacgtccgtccacgtgaggagcccagcc
aggccctctgagagccgcctggcccccactcccacggaggggaaagtccgccctcgtgtg
accaatagctccccgatgggctggtcgtcagctgccccgtgcacagcagcggctgcctcc
catcccgccgtgcccccgagtgccccagaccctcgcccggccacaccccagggtggggga
gccccccgagtggcagctcctcaaaccacactcagttcaagctccacatctgcagccacg
gtggaccccccagcctggaccccgtccgcctccaggacccagcaggcccggaataagttt
ttccaaacatcagcagtgccccccggcaccagcctttctggcagaggtcccaccccgtca
cttgttctatccaaggacagcagcaaggagcaggcgcggaacttcctcaagcaggccctc
tcagcgctggaagaggctggcgctccggcgcctggcaggccctccccagccactgccgct
gttcccagttctcagcccaaaactgaagcaccacaagcaagtcccttagccaagccgtta
cagtcctcgtctccccgggtgcttggcctcccttcgaggatggaaccgccagccccgctg
agcacgagcagtacctctcaggcatccgcgttgcccccggcaggcaggaggaacttggcg
gaatcctcaggggtcggcagggtgggtgctggctccaggccgaagccagaggccccgatg
gcaaagggtaaaagcaccaccttaacgcaggacatgagcaccagcctccaggaaggccag
gaggacgggccggcaggatggagagcgaatctgaagcccgtggacaggagaagcccagct
gagaggactctgaagcccaaggaaccacgggccctggcagagccgagggcgggggaggcc
cccaggaaggtctcaggcagctttgctgggagtgtccacatcaccctgacccccgtgagg
cctgacaggaccccacgcccagccagcccaggacccagcctcccagccaggtccccctcc
ccaccccgccgcaggagactggccgtccctgccagcctcgacgtttgtgacaactggctt
cggccggagccccctggccaggaagcccgagtgcagagctggaaggaggaggagaagaaa
cctcaccttcagggcaaaccagggagacccttgtccccggccaatgtccctgctctgcct
ggcgagacggtgacctccccagtcaggctgcaccccgactacctctccccggaggagata
cagaggcagctgcaggacatcgagaggcggctggacgccctggagctccgcggcgtggag
ctggagaagcgactgcgggcggccgagggagatgacgctgaggatagcctcatggtggac
tggttctggctcattcacgagaagcagcttctgctgagacaggagtcagagctgatgtac
aagtccaaggcccagcgtctggaggagcagcagctggacatcgagggcgagctgcgccgg
ctcatggccaagcccgaggctctgaagtcactgcaggagcggcggcgggagcaggagctg
ctggagcagtacgtgagcaccgtgaacgaccgcagtgacatcgtggactcgctggacgag
gaccggctccgggaacaagaggaggatcagatgctgcgggacatgattgagaagctgggc
ctccagaggaagaagtccaagttccgcttgtccaagatctggtcaccaaaaagcaaaagc
agcccctcccagtag

DBGET integrated database retrieval system