KEGG   Homo sapiens (human): 79798Help
Entry
79798             CDS       T01001                                 

Gene name
ARMC5, AIMAH2
Definition
(RefSeq) armadillo repeat containing 5
  KO
K22499  armadillo repeat-containing protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04934  Cushing syndrome
Disease
H01431  Cushing syndrome
H02049  Bilateral macronodular adrenal hyperplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    79798 (ARMC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm BTB HEAT_2 HEAT_EZ Neurochondrin
Motif
Other DBs
NCBI-GeneID: 79798
NCBI-ProteinID: NP_001098717
OMIM: 615549
HGNC: 25781
Ensembl: ENSG00000140691
Vega: OTTHUMG00000176618
Pharos: Q96C12(Tbio)
UniProt: Q96C12
LinkDB All DBs
Position
16p11.2
AA seq 935 aa AA seqDB search
MAAAKPTLTDSLSFCLAQLAAAAGEALGGEKDPATNETPLSRALLALRTRHIKAAGGIER
FRARGGLRPLLALLRRAAAAGSAPSQAGPGSAPSSAASGASSPAPASGPAPSAVSSSSPT
PPVRLRKTLDLALSILADCCTEGACRTEVRRLGGILPLVTILQCMKTDSIQNRTARALGN
LAMEPESCGDIHCAGAVPLLVESLTACQDSQCLQSVVRALRNLADSPQHRLALAQQGAVR
PLAELLATAPDAALTLALVRALLELSRGCSRACAEQLSLGGGLGPLVSLASHPKRAVREG
TILILANLCAQGLIRPALGNAGGVEVLVDELRQRRDPNGASPTSQQPLVRAVCLLCREAI
NRARLRDAGGLDLLMGLLRDPRASAWHPRIVAALVGFLYDTGALGRLQALGLVPLLAGQL
CGEAGEEEEEGREAASWDFPEERTPERAQGGSFRSLRSWLISEGYATGPDDISPDWSPEQ
CPPEPMEPASPAPTPTSLRAPRTQRTPGRSPAAAIEEPWGREGPALLLLSRFSQAPDPSG
ALVTGPALYGLLTYVTGAPGPPSPRALRILSRLTCNPACLEAFVRSYGAALLRAWLVLGV
APDDWPAPRARPTLHSRHRELGERLLQNLTVQAESPFGVGALTHLLLSGSPEDRVACALT
LPFICRKPSLWRRLLLEQGGLRLLLAALTRPAPHPLFLFFAADSLSCLQDLVSPTVSPAV
PQAVPMDLDSPSPCLYEPLLGPAPVPAPDLHFLLDSGLQLPAQRAASATASPFFRALLSG
SFAEAQMDLVPLRGLSPGAAWPVLHHLHGCRGCGAALGPVPPPGQPLLGSEAEEALEAAG
RFLLPGLEEELEEAVGRIHLGPQGGPESVGEVFRLGRPRLAAHCARWTLGSEQCPRKRGL
ALVGLVEAAGEEAGPLTEALLAVVMGIELGARVPA
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgcgaagccaaccctcacggactcgctctcgttctgcctcgcgcagctcgcg
gcggcggccggggaggctctgggtggggaaaaggacccagcgaccaacgagacacccctg
agccgcgcgctcctagccctccgcacgcgccacatcaaggcagcggggggaatcgagcgc
ttccgggcacgcggcgggctccgccccctactcgcgctgctacggcgagcggctgcagcg
ggttccgccccgtcccaggcaggccccggctccgccccctcgtcggccgcgtcgggagct
tctagccccgcccccgcgtcgggccccgccccctccgctgtgtcgtcgtctagtcctacg
ccgccagtgcgcctgcgcaagacgctggacttggcgctcagcatcctagccgattgctgt
acggaaggggcgtgccggaccgaagtgcgcagactcggaggcatactccctttggtgacc
attcttcagtgcatgaagacagacagcatccagaaccgaacggcccgtgccctggggaac
ttagccatggaacctgagagctgtggggacatccactgtgctggtgctgttcccctgctt
gtggagagcctgacagcctgccaggactcgcagtgcctacagagcgtggtgcgtgccctc
cgtaacctggcagactcaccccagcaccgcctggccttggcacagcagggagcagtgcgt
ccgctggccgagctcctggccactgccccagatgctgcactgaccttagccctcgtccgt
gccctcctggaactcagccgaggctgctcccgggcctgtgctgagcagctaagtctgggt
gggggattgggcccactcgtcagcctggcttcccaccccaagcgggcagtacgcgaggga
accattctgatcctcgccaacctgtgtgcccagggcctgattcggcctgcactgggcaat
gctggtggcgtggaggtgctggtagatgagctccggcagcgccgggatcctaatggagct
agcccaacctcccagcagcccctggtgcgggctgtgtgcctcctatgtcgtgaggccatc
aaccgggcccgactgcgggatgctggtggcttggatctactgatgggcctgctgcgggac
cctcgtgcaagcgcatggcaccctcgtattgtggctgcccttgtggggtttctgtatgac
actggggccctgggccggctgcaggctctgggacttgtgcctctcctggctgggcagctg
tgtggtgaggctggtgaggaggaagaagagggaagagaagctgcttcctgggactttcct
gaggagaggacccctgagcgggcacagggtggaagcttccggagcctcaggtcgtggctg
atctccgagggctatgccacaggccctgatgacatctcccccgactggtctcctgagcag
tgtccgccggagcccatggagccggccagccccgccccgaccccgacctcgctgcgggca
ccacgcacccaacgcactccgggccgcagccccgccgccgccatcgaggagccttgggga
cgcgaagggccagccctgctgctgctgtcgcgcttttcccaggcccctgacccaagtggg
gcacttgtgaccggcccggcgctgtacggcctgctgacctatgtgaccggcgcaccgggc
ccgcccagcccacgtgcactgcgcattctgtcacgcctcacctgcaaccctgcctgcctc
gaggccttcgtgcgcagctatggcgcggcgctgctgcgggcctggctggtgctgggggtg
gcgcctgacgattggccggcaccacgtgcccggcccactctccacagccggcaccgagag
ctgggggagaggctactgcagaacctgacggttcaggctgagtcgccctttggggttggg
gccctgacgcacctgctgctctctgggagccctgaggaccgagtggcctgcgcgctgacc
ctgcccttcatctgccggaagccctctctgtggcgccggctgcttctggagcagggtggt
ctccggctcctccttgcggcgctgacccggccggccccacacccgctcttcctcttcttt
gccgcggactccctttcctgcctccaagacctggtgtctcccactgtgagcccagctgtc
ccacaggcagtccccatggacctagactcaccttccccttgcctctatgaacctctgctg
ggcccagcccctgtcccagctcccgacctgcacttcctgctggactcaggcctccagctc
cctgcccagcgagcggcctcagccaccgcctcccctttcttccgggccctgctgtcaggc
agctttgcagaagcccagatggacctggtgcccctgcgaggtctgtcgcctggtgcagcc
tggcctgtcctgcatcatttgcatggttgtcgggggtgtggggctgccctggggcccgtg
cccccaccaggccagcccctgctgggttcagaggccgaggaggcactggaggctgctggc
cgtttcctactgcctgggctggaggaggagctggaagaggccgtgggccgcatccacctg
ggaccccagggtggcccggagtcagtgggtgaggtgttccgcctgggccggccccggctg
gctgcccactgtgcccgctggacactggggtcagagcagtgcccgaggaagcggggtctg
gccctggtggggcttgtggaggcagcaggtgaagaggcagggcccctgacggaggctttg
ctggctgtggtgatggggattgagttgggggcaagggtccctgcctag

DBGET integrated database retrieval system