KEGG   Homo sapiens (human): 79923Help
Entry
79923             CDS       T01001                                 

Gene name
NANOG
Definition
(RefSeq) Nanog homeobox
  KO
K10164  homeobox protein Nanog
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05205  Proteoglycans in cancer
Drug target
Amcasertib: D10903
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    79923 (NANOG)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    79923 (NANOG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    79923 (NANOG)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, not assigned
    79923 (NANOG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homez
Motif
Other DBs
NCBI-GeneID: 79923
NCBI-ProteinID: NP_079141
OMIM: 607937
HGNC: 20857
Ensembl: ENSG00000111704
Vega: OTTHUMG00000166019
Pharos: Q9H9S0(Tbio)
UniProt: Q9H9S0 A8K4D1
LinkDB All DBs
Structure
PDB: 

Position
12p13.31
AA seq 305 aa AA seqDB search
MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDL
LIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYL
SLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSS
YHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPF
YNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNM
QPEDV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtggatccagcttgtccccaaagcttgccttgctttgaagcatccgactgtaaa
gaatcttcacctatgcctgtgatttgtgggcctgaagaaaactatccatccttgcaaatg
tcttctgctgagatgcctcacacggagactgtctctcctcttccttcctccatggatctg
cttattcaggacagccctgattcttccaccagtcccaaaggcaaacaacccacttctgca
gagaagagtgtcgcaaaaaaggaagacaaggtcccggtcaagaaacagaagaccagaact
gtgttctcttccacccagctgtgtgtactcaatgatagatttcagagacagaaatacctc
agcctccagcagatgcaagaactctccaacatcctgaacctcagctacaaacaggtgaag
acctggttccagaaccagagaatgaaatctaagaggtggcagaaaaacaactggccgaag
aatagcaatggtgtgacgcagaaggcctcagcacctacctaccccagcctttactcttcc
taccaccagggatgcctggtgaacccgactgggaaccttccaatgtggagcaaccagacc
tggaacaattcaacctggagcaaccagacccagaacatccagtcctggagcaaccactcc
tggaacactcagacctggtgcacccaatcctggaacaatcaggcctggaacagtcccttc
tataactgtggagaggaatctctgcagtcctgcatgcagttccagccaaattctcctgcc
agtgacttggaggctgccttggaagctgctggggaaggccttaatgtaatacagcagacc
actaggtattttagtactccacaaaccatggatttattcctaaactactccatgaacatg
caacctgaagacgtgtga

DBGET integrated database retrieval system