KEGG   Homo sapiens (human): 80142Help
Entry
80142             CDS       T01001                                 

Gene name
PTGES2, C9orf15, GBF-1, GBF1, PGES2, mPGES-2
Definition
(RefSeq) prostaglandin E synthase 2
  KO
K05309  microsomal prostaglandin-E synthase 2 [EC:5.3.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
Disease
H00025  Penile cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    80142 (PTGES2)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.3  prostaglandin-E synthase
     80142 (PTGES2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 Glutaredoxin GST_N_2 GST_N_4 GST_C_2 GST_C GST_N GST_C_3
Motif
Other DBs
NCBI-GeneID: 80142
NCBI-ProteinID: NP_079348
OMIM: 608152
HGNC: 17822
Ensembl: ENSG00000148334
Vega: OTTHUMG00000020730
Pharos: Q9H7Z7(Tchem)
UniProt: Q9H7Z7 B3KPZ2
LinkDB All DBs
Position
9q34.11
AA seq 377 aa AA seqDB search
MDPAARVVRALWPGGCALAWRLGGRPQPLLPTQSRAGFAGAAGGPSPVAAARKGSPRLLG
AAALALGGALGLYHTARWHLRAQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFL
DFHALPYQVVEVNPVRRAEIKFSSYRKVPILVAQEGESSQQLNDSSVIISALKTYLVSGQ
PLEEIITYYPAMKAVNEQGKEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADD
WLVHLISPNVYRTPTEALASFDYIVREGKFGAVEGAVAKYMGAAAMYLISKRLKSRHRLQ
DNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLDAFDDLMQHTHIQ
PWYLRVERAITEASPAH
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggacccggctgcgcgggtggtgcgggcgctgtggcctggtgggtgcgccttggcctgg
aggctgggaggccgcccccagccgctgctacccacgcagagccgggctggcttcgcgggg
gcggcgggcggcccgagccccgtggctgcagctcgtaaggggagcccgcggctgctggga
gctgcggcgctggccctggggggagccctggggctgtaccacacggcgcggtggcacctg
cgcgcccaggacctccacgcagagcgctcagccgcgcagctctccctgtccagccgcctg
cagctgaccctgtaccagtacaagacgtgtcccttctgcagcaaggtccgagccttcctc
gacttccatgccctgccctaccaggtggtggaggtgaaccctgtgcgcagggctgagatc
aagttctcctcctacagaaaggtgcccatcctggtggcccaggaaggagaaagctcgcaa
caactaaatgactcctctgtcatcatcagcgccctcaagacctacctggtgtcggggcag
cccctggaagagatcatcacctactacccagccatgaaggctgtgaacgagcagggcaag
gaggtgaccgagttcggcaataagtactggctcatgctcaacgagaaggaggcccagcaa
gtgtatggtgggaaggaggccaggacggaggagatgaagtggcggcagtgggcggacgac
tggctggtgcacctgatctcccccaatgtgtaccgcacgcccaccgaggctctggcgtcc
tttgactacattgtccgcgagggcaagttcggagccgtggagggtgccgtggccaagtac
atgggtgcagcggccatgtacctcatcagcaagcgactcaagagcaggcaccgcctccag
gacaacgtgcgcgaggacctctatgaggctgctgacaagtgggtggctgctgtgggcaag
gaccggcccttcatggggggccagaagccgaatctcgctgatttggcggtgtatggcgtg
ctgcgtgtgatggaggggctggatgcgttcgatgacctgatgcagcacacgcacatccag
ccctggtacctgcgggtggagagggccatcaccgaggcctccccagcgcactga

DBGET integrated database retrieval system