KEGG   Homo sapiens (human): 80230Help
Entry
80230             CDS       T01001                                 

Gene name
RUFY1, RABIP4, ZFYVE12
Definition
(RefSeq) RUN and FYVE domain containing 1
  KO
K12482  RUN and FYVE domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    80230 (RUFY1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    80230 (RUFY1)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    80230 (RUFY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RUN FYVE zf-RING_5 YabA IBR Baculo_IE-1 HypA
Motif
Other DBs
NCBI-GeneID: 80230
NCBI-ProteinID: NP_079434
OMIM: 610327
HGNC: 19760
Ensembl: ENSG00000176783
Vega: OTTHUMG00000130913
Pharos: Q96T51(Tbio)
UniProt: Q96T51
LinkDB All DBs
Structure
PDB: 

Position
5q35.3
AA seq 708 aa AA seqDB search
MADREGGCAAGRGRELEPELEPGPGPGSALEPGEEFEIVDRSQLPGPGDLRSATRPRAAE
GWSAPILTLARRATGNLSASCGSALRAAAGLGGGDSGDGTARAASKCQMMEERANLMHMM
KLSIKVLLQSALSLGRSLDADHAPLQQFFVVMEHCLKHGLKVKKSFIGQNKSFFGPLELV
EKLCPEASDIATSVRNLPELKTAVGRGRAWLYLALMQKKLADYLKVLIDNKHLLSEFYEP
EALMMEEEGMVIVGLLVGLNVLDANLCLKGEDLDSQVGVIDFSLYLKDVQDLDGGKEHER
ITDVLDQKNYVEELNRHLSCTVGDLQTKIDGLEKTNSKLQEELSAATDRICSLQEEQQQL
REQNELIRERSEKSVEITKQDTKVELETYKQTRQGLDEMYSDVWKQLKEEKKVRLELEKE
LELQIGMKTEMEIAMKLLEKDTHEKQDTLVALRQQLEEVKAINLQMFHKAQNAESSLQQK
NEAITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQL
HEQCSSLEKELKSEKEQRQALQRELQHEKDTSSLLRMELQQVEGLKKELRELQDEKAELQ
KICEEQEQALQEMGLHLSQSKLKMEDIKEVNQALKGHAWLKDDEATHCRQCEKEFSISRR
KHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLLQRCSSTAS
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccgggaaggcggctgcgctgctgggcgggggcgggagctggagccggagctg
gagccggggccggggcccgggtcagcgcttgagccgggagaagagtttgagatcgtggac
cgaagccagctgcccggcccaggcgacctgcggagcgcaacgaggccgcgggcggccgag
ggctggtcggcgcccatcctgaccctggcacgcagggccaccgggaacctgtcggcgagc
tgcgggagcgcgctgcgcgcggccgcggggctgggcggcggggacagcggggacggcacg
gcgcgcgcagcttctaagtgccagatgatggaggagcgtgccaacctgatgcacatgatg
aaactcagcatcaaggtgttgctccagtcggctctgagcctgggccgcagcctggatgcg
gaccatgcccccttgcagcagttctttgtagtgatggagcactgcctcaaacatgggctg
aaagttaagaagagttttattggccaaaataaatcattctttggtcctttggagctggtg
gagaaactttgtccagaagcatcagatatagcgactagtgtcagaaatcttccagaatta
aagacagctgtgggaagaggccgagcgtggctttatcttgcactcatgcaaaagaaactg
gcagattatctgaaagtgcttatagacaataaacatctcttaagcgagttctatgagcct
gaggctttaatgatggaggaagaagggatggtgattgttggtctgctggtgggactcaat
gttctcgatgccaatctctgcttgaaaggagaagacttggattctcaggttggagtaata
gatttttccctctaccttaaggatgtgcaggatcttgatggtggcaaggagcatgaaaga
attactgatgtccttgatcaaaaaaattatgtggaagaacttaaccggcacttgagctgc
acagttggggatcttcaaaccaagatagatggcttggaaaagactaactcaaagcttcaa
gaagagctttcagctgcaacagaccgaatttgctcacttcaagaagaacagcagcagtta
agagaacaaaatgaattaattcgagaaagaagtgaaaagagtgtagagataacaaaacag
gataccaaagttgagctggagacttacaagcaaactcggcaaggtctggatgaaatgtac
agtgatgtgtggaagcagctaaaagaggagaagaaagtccggttggaactggaaaaagaa
ctggagttacaaattggaatgaaaaccgaaatggaaattgcaatgaagttactggaaaag
gacacccacgagaagcaggacacactagttgccctccgccagcagctggaagaagtcaaa
gcgattaatttacagatgtttcacaaagctcagaatgcagagagcagtttgcagcagaag
aatgaagccatcacatcctttgaaggaaaaaccaaccaagttatgtccagcatgaaacaa
atggaagaaaggttgcagcactcggagcgggcgaggcagggggctgaggagcggagccac
aagctgcagcaggagctgggcgggaggatcggcgccctgcagctgcagctctcccagctg
cacgagcaatgctcaagcctggagaaagaattgaaatcagaaaaagagcaaagacaggct
cttcagcgcgaattacagcacgagaaagacacttcctctctactcaggatggagctgcaa
caagtggaaggactgaaaaaggagttgcgggagcttcaggacgagaaggcagagctgcag
aagatctgcgaggagcaggaacaagccctccaggaaatgggcctgcacctcagccagtcc
aagctgaagatggaagatataaaagaagtgaaccaggcactgaagggccacgcctggctg
aaagatgacgaagcgacacactgtaggcagtgtgagaaggagttctccatttcccggaga
aagcaccactgccggaactgtggccacatcttctgcaacacctgctccagcaacgagctg
gccctgccctcctaccccaagccggtgcgagtgtgcgacagctgccacaccctgctcctg
cagcgctgctcctccacggcctcctga

DBGET integrated database retrieval system