KEGG   Homo sapiens (human): 8028Help
Entry
8028              CDS       T01001                                 

Gene name
MLLT10, AF10
Definition
(RefSeq) MLLT10 histone lysine methyltransferase DOT1L cofactor
Organism
hsa  Homo sapiens (human)
Disease
H00002  T-cell acute lymphoblastic leukemia
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H_2 zf-HC5HC2H PHD_2 PHD
Motif
Other DBs
NCBI-GeneID: 8028
NCBI-ProteinID: NP_001182555
OMIM: 602409
HGNC: 16063
Ensembl: ENSG00000078403
Vega: OTTHUMG00000017799
Pharos: P55197(Tbio)
UniProt: P55197 Q59EQ6 Q6N002
LinkDB All DBs
Structure
PDB: 

Position
10p12.31
AA seq 1068 aa AA seqDB search
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQ
VPTGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVSTM
EPIVLQSVPHDRYNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE
EGNGADNVQYCGYCKYHFSKLKKSKRGSNRSYDQSLSDSSSHSQDKHHEKEKKKYKEKDK
HKQKHKKQPEPSPALVPSLTVTTEKTYTSTSNNSISGSLKRLEDTTARFTNANFQEVSAH
TSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGL
PSTSAVTSQPKSFENSPGDLGNSSLPTAGYKRAQTSGIEEETVKEKKRKGNKQSKHGPGR
PKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQYRHDGACPTTTFSELLNAIHNGIYNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQS
SGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMYGNRSNSSMAALIAQSEN
NQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRYDQPGNSSLENLPPVAASIEQLL
ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSV
PFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQS
TSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG
ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLL
SDQQRQILIHQQQFQQLLNSQQLTPEQHQAFLYQLMQHHHQQHHQPELQQLQIPGPTQIP
INNLLAGTQAPPLHTATTNPFLTIHGDNASQKVARLSDKTGPVAQEKS
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atggtctctagcgaccggcccgtgtcactggaggacgaggtctcccatagtatgaaggag
atgattggaggctgttgcgtttgctcagacgagagaggctgggccgagaacccgctggtt
tattgcgacgggcacggctgcagcgtcgcggtgcatcaagcttgctatggcattgttcaa
gtacccactggaccgtggttttgcaggaaatgtgaatctcaggagagagcagccagagtg
agatgtgaactttgtccccataaggatggagctttaaaaagaacagataatgggggttgg
gcccatgtggtttgtgccctgtatattccagaggtacaatttgccaatgtttccacaatg
gaaccaattgttttacagtctgttccgcatgatcgttataataagacttgctacatttgt
gatgaacaaggaagagaaagcaaagcagccactggtgcttgcatgacatgtaataaacat
ggatgtcgacaggctttccatgtaacatgcgctcagtttgccggactgctttgtgaagaa
gaaggtaatggtgccgataatgtccaatactgtggctactgtaaataccattttagtaag
ctgaaaaagagcaaacggggatctaataggtcatatgatcaaagtttaagtgattcttcc
tctcactctcaggataaacatcatgagaaagagaaaaaaaaatataaagagaaggacaaa
cacaaacagaaacacaagaagcagccagaaccatcacctgcattggttccatccttgact
gttactacagaaaaaacttatacaagcactagcaacaactctatatctggatcattgaag
cgcttggaagatactactgcacgatttacaaatgcaaatttccaggaagtctctgcacac
acctctagtggaaaagatgtttcagagactagagggtcagagggcaaagggaagaaatct
tcagctcacagctcaggtcaaaggggaagaaagcctggtggtggaagaaatccaggaaca
actgtgtcagcagctagcccttttcctcaaggcagtttttcaggaactccaggcagtgta
aagtcatcttctggaagttcagtgcagtctccccaggatttcctgagctttacagactca
gatctgcgtaatgacagttactctcactcccaacagtcatcagcaaccaaagatgtacat
aaaggagagtctggaagccaggaagggggggtaaatagttttagtaccttaattggcctc
ccttcaacctcagctgttacttcacagcctaaaagctttgaaaattcacctggagatttg
ggtaattccagccttcctacagcaggatataagcgggctcaaacttctggcatagaagaa
gaaactgtaaaggaaaagaaaaggaaaggaaataaacaaagtaagcatgggcctggcaga
cccaaaggaaacaaaaatcaagagaatgtttctcatctctcagtttcttctgcttcacca
acatcatctgtagcatcagctgcaggaagcataacaagctctagtctgcagaaatctcct
acattgctcaggaatggaagtttacagagcctcagtgttggctcatctccagttggttca
gaaatttccatgcagtatcggcatgatggagcttgcccaacaactacgttctcagagttg
ctgaatgcaatacacaacggtatttataacagcaatgatgtagcagtatcgtttccaaat
gtagtatctggctcgggatctagtactcctgtctccagctctcacttacctcagcagtct
tctgggcatttgcaacaagtaggagcgctctctccctcagctgtgtcatctgcagcccct
gctgttgctacaactcaggcaaatactctatctggatcttctctcagtcaggcaccatct
catatgtatggcaatagatcaaattcatcaatggcagctcttatagctcagtctgaaaac
aatcaaacagatcaagatcttggagacaatagccgcaacctagttggcagaggaagctca
ccccgaggaagtctctcgccacgatcccctgtaagcagcttacagattcgctatgatcaa
ccaggcaacagcagtttggaaaatctgcctccagtagcagccagcatagaacagcttttg
gagaggcagtggagtgaaggacagcaatttttactagaacagggtactcctagtgacatt
ttaggaatgctgaagtcattacaccaacttcaagttgaaaaccgaagattagaggaacaa
attaaaaacttgactgccaaaaaggaacggcttcagttattgaatgcacagctttcagtg
ccttttccaacaataacagcaaatcctagtccgtctcatcaaatacacacattttcagca
cagactgctcctactactgattccttgaacagcagtaagagccctcatataggaaacagc
tttttacctgataattctcttcctgtattaaatcaggacttaacctccagtggacaaagt
accagcagctcatcagctctttctaccccacctcctgctgggcagagtccggctcaacaa
ggctcaggagtgagtggagttcagcaggtcaatggcgtgacagtgggggcactagctagt
ggaatgcagcctgtaacttccaccattcctgccgtgtctgcagtgggtggaataattgga
gctttgccaggtaaccaactggcaattaatggcattgtaggagctttaaatggggttatg
cagactcctgtcacaatgtcccagaaccctacccctctcacccacacaaccgtaccacct
aatgcaacacatccaatgccagctacactgactaacagtgcctcaggactaggattactt
tctgaccagcaacgacaaatacttattcatcaacagcagtttcagcagttgttaaattct
caacagctcacaccagaacaacatcaagcctttttgtatcagttaatgcaacatcaccac
cagcagcaccaccaacctgaacttcagcagctgcagatccctggaccaacacaaataccc
ataaacaaccttcttgcaggtacacaggcacccccacttcacacagctaccaccaaccca
tttctcaccatccatggagataatgcaagtcagaaagtagcaagacttagtgataaaact
gggcctgtagctcaagagaaaagttga

DBGET integrated database retrieval system