KEGG   Homo sapiens (human): 8031Help
Entry
8031              CDS       T01001                                 

Gene name
NCOA4, ARA70, ELE1, PTC3, RFG
Definition
(RefSeq) nuclear receptor coactivator 4
  KO
K09289  nuclear receptor coactivator 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04216  Ferroptosis
hsa05200  Pathways in cancer
hsa05216  Thyroid cancer
Disease
H00032  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    8031 (NCOA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8031 (NCOA4)
  09162 Cancer: specific types
   05216 Thyroid cancer
    8031 (NCOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARA70
Motif
Other DBs
NCBI-GeneID: 8031
NCBI-ProteinID: NP_001138734
OMIM: 601984
HGNC: 7671
Ensembl: ENSG00000266412
Vega: OTTHUMG00000188314
Pharos: Q13772(Tbio)
UniProt: Q13772 A0A024QZI5 Q96E88
LinkDB All DBs
Position
10q11.22
AA seq 614 aa AA seqDB search
MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHL
ECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSV
CLERLGSLTLKPEDSTVLLFEADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLE
KRGCISMPEQKSASGIVAVPFSEWLLGSKPASGYQAPYIPSTDPQDWLTQKQTLENSQTS
SRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSSFSIEMEKVGDQELPDQDEMD
LSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNCQGNQPKGVEI
ENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDE
NCEKEALYKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPRKEVIEQTKAPKAMTPS
RIADSFQVIKNSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWV
LPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLK
VDKEKWLYRTPLQM
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaataccttccaagaccagagtggcagctccagtaatagagaaccccttttgaggtgt
agtgatgcacggagggacttggagcttgctattggtggagttctccgggctgaacagcaa
attaaagataacttgcgagaggtcaaagctcagattcacagttgcataagccgtcacctg
gaatgtcttagaagccgtgaggtatggctgtatgaacaggtggaccttatttatcagctt
aaagaggagacacttcaacagcaggctcagcagctctactcgttattgggccagttcaat
tgtcttactcatcaactggagtgtacccaaaacaaagatctagccaatcaagtctctgtg
tgcctggagagactgggcagtttgacccttaagcctgaagattcaactgtcctgctcttt
gaagctgacacaattactctgcgccagaccatcaccacatttgggtctctcaaaaccatt
caaattcctgagcacttgatggctcatgctagttcagcaaatattgggcccttcctggag
aagagaggctgtatctccatgccagagcagaagtcagcatccggtattgtagctgtccct
ttcagcgaatggctccttggaagcaaacctgccagtggttatcaagctccttacataccc
agcaccgacccccaggactggcttacccaaaagcagaccttggagaacagtcagacttct
tccagagcctgcaatttcttcaataatgtcgggggaaacctaaagggcttagaaaactgg
ctcctcaagagtgaaaaatcaagttatcaaaagtgtaacagccattccactactagttct
ttctccattgaaatggaaaaggttggagatcaagagcttcctgatcaagatgagatggac
ctatcagattggctagtgactccccaggaatcccataagctgcggaagcctgagaatggc
agtcgtgaaaccagtgagaagtttaagctcttattccagtcctataatgtgaatgattgg
cttgtcaagactgactcctgtaccaactgtcagggaaaccagcccaaaggtgtggagatt
gaaaacctgggcaatctgaagtgcctgaatgaccacttggaggccaagaaaccattgtcc
acccccagcatggttacagaggattggcttgtccagaaccatcaggacccatgtaaggta
gaggaggtgtgcagagccaatgagccctgcacaagctttgcagagtgtgtgtgtgatgag
aattgtgagaaggaggctctgtataagtggcttctgaagaaagaaggaaaggataaaaat
gggatgcctgtggaacccaaacctgagcctgagaagcataaagattccctgaatatgtgg
ctctgtcctagaaaagaagtaatagaacaaactaaagcaccaaaggcaatgactccttct
agaattgctgattccttccaagtcataaagaacagccccttgtcggagtggcttatcagg
cccccatacaaagaaggaagtcccaaggaagtgcctggtactgaagacagagctggcaaa
cagaagtttaaaagccccatgaatacttcctggtgttcctttaacacagctgactgggtc
ctgccaggaaagaagatgggcaacctcagccagttatcttctggagaagacaagtggctg
cttcgaaagaaggcccaggaagtattacttaattcacctctacaggaggaacataacttc
cccccagaccattatggcctccctgcagtttgtgatctctttgcctgtatgcagcttaaa
gttgataaagagaagtggttatatcgaactcctctacagatgtga

DBGET integrated database retrieval system