KEGG   Homo sapiens (human): 80326Help
Entry
80326             CDS       T01001                                 

Gene name
WNT10A, OODD, SSPS, STHAG4
Definition
(RefSeq) Wnt family member 10A
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Disease
H00625  Tooth agenesis
H00646  Odontoonychodermal dysplasia
H00781  Schopf-Schulz-Passarge syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    80326 (WNT10A)
   04390 Hippo signaling pathway
    80326 (WNT10A)
   04150 mTOR signaling pathway
    80326 (WNT10A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    80326 (WNT10A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    80326 (WNT10A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    80326 (WNT10A)
   05205 Proteoglycans in cancer
    80326 (WNT10A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    80326 (WNT10A)
   05226 Gastric cancer
    80326 (WNT10A)
   05217 Basal cell carcinoma
    80326 (WNT10A)
   05224 Breast cancer
    80326 (WNT10A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    80326 (WNT10A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    80326 (WNT10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    80326 (WNT10A)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Morphogens
   80326 (WNT10A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt Ebola_NP
Motif
Other DBs
NCBI-GeneID: 80326
NCBI-ProteinID: NP_079492
OMIM: 606268
HGNC: 13829
Ensembl: ENSG00000135925
Vega: OTTHUMG00000133085
Pharos: Q9GZT5(Tbio)
UniProt: Q9GZT5 A0A2K8FR47
LinkDB All DBs
Position
2q35
AA seq 417 aa AA seqDB search
MGSAHPRPWLRLRPQPQPRPALWVLLFFLLLLAAAMPRSAPNDILDLRLPPEPVLNANTV
CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES
PIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLD
ALQRGKGLSHGVPEHPALPTASPGLQDSWEWGGCSPDMGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRSRFHRATLI
RPHNRNGGQLEPGPAGAPSPAPGAPGPRRRASPADLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSAGSDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcgcccaccctcgcccctggctgcggctccgaccccagccccagccgcggcca
gcgctctgggtgctcctgttcttcctactgctgctggctgctgccatgcccaggtcagca
cccaatgacattctggacctccgcctccccccggagcccgtgctcaatgccaacacagtg
tgcctaacattgccaggcctgagccggcggcagatggaggtgtgtgtgcgtcaccctgat
gtggctgcctcagccatacagggcatccagatcgccatccacgaatgccaacaccaattc
agggaccagcgctggaactgctcaagcctggagactcgcaacaagatcccctatgagagt
cccatcttcagcagaggtttccgagagagcgcttttgcctacgccatcgcagcagctggc
gtggtgcacgccgtgtccaatgcgtgtgccctgggcaaactgaaggcctgtggctgtgat
gcgtcccggcgaggggacgaggaggccttccgtaggaagctgcaccgcttacaactggat
gcactgcagcgtggtaagggcctgagccatggggtcccggaacacccagccctgcccaca
gccagcccaggcctgcaggactcctgggagtggggcggctgcagccccgacatgggcttc
ggggagcgcttttctaaggactttctggactcccgggagcctcacagagacatccacgcg
agaatgaggcttcacaacaaccgagttgggaggcaggcagtgatggagaacatgcggcgg
aagtgcaagtgccacggcacgtcaggcagctgccagctcaagacgtgctggcaggtgacg
cccgagttccgcaccgtgggggcgctgctgcgcagccgcttccaccgcgccacgctcatc
cggccgcacaaccgcaacggcggccagctggagccgggcccagcgggggcaccctcgccg
gctccgggcgctcccgggccgcgccgacgggccagccccgccgacctggtctacttcgaa
aagtctcccgacttctgcgagcgcgagccgcgcctggactcggcgggcaccgtgggccgc
ctgtgcaacaagagcagcgccggctcggatggctgcggcagcatgtgctgcggccgcggc
cacaacatcctgcgccagacgcgcagcgagcgctgccactgccgcttccactggtgctgt
ttcgtggtctgcgaagagtgccgcatcaccgagtgggtcagcgtctgcaagtga

DBGET integrated database retrieval system