KEGG   Homo sapiens (human): 8061Help
Entry
8061              CDS       T01001                                 

Gene name
FOSL1, FRA, FRA1, fra-1
Definition
(RefSeq) FOS like 1, AP-1 transcription factor subunit
  KO
K04502  fos-like antigen 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04380  Osteoclast differentiation
hsa04657  IL-17 signaling pathway
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
  Element
N00509  HTLV-1 Tax to SRF-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8061 (FOSL1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    8061 (FOSL1)
  09158 Development
   04380 Osteoclast differentiation
    8061 (FOSL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    8061 (FOSL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    8061 (FOSL1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    8061 (FOSL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF3450 Siah-Interact_N HALZ Macoilin DUF4407 UPF0242
Motif
Other DBs
NCBI-GeneID: 8061
NCBI-ProteinID: NP_005429
OMIM: 136515
HGNC: 13718
Ensembl: ENSG00000175592
Vega: OTTHUMG00000166715
Pharos: P15407(Tbio)
UniProt: P15407 A0A0S2Z595
LinkDB All DBs
Position
11q13.1
AA seq 271 aa AA seqDB search
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLG
PSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAA
KCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKE
GDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPST
PEPCASAHRKSSSSSGDPSSDPLGSPTLLAL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgttccgagacttcggggaacccggcccgagctccgggaacggcggcgggtacggcggc
cccgcgcagcccccggccgcagcgcaggcagcccagcagaagttccacctggtgccaagc
atcaacaccatgagtggcagtcaggagctgcagtggatggtacagcctcatttcctgggg
cccagcagttaccccaggcctctgacctaccctcagtacagccccccacaaccccggcca
ggagtcatccgggccctggggccgcctccaggggtacgtcgaaggccttgtgaacagatc
agcccggaggaagaggagcgccgccgagtaaggcgcgagcggaacaagctggctgcggcc
aagtgcaggaaccggaggaaggaactgaccgacttcctgcaggcggagactgacaaactg
gaagatgagaaatctgggctgcagcgagagattgaggagctgcagaagcagaaggagcgc
ctagagctggtgctggaagcccaccgacccatctgcaaaatcccggaaggagccaaggag
ggggacacaggcagtaccagtggcaccagcagcccaccagccccctgccgccctgtacct
tgtatctccctttccccagggcctgtgcttgaacctgaggcactgcacacccccacactc
atgaccacaccctccctaactcctttcacccccagcctggtcttcacctaccccagcact
cctgagccttgtgcctcagctcatcgcaagagtagcagcagcagcggagacccatcctct
gacccccttggctctccaaccctcctcgctttgtga

DBGET integrated database retrieval system