KEGG   Homo sapiens (human): 80818Help
Entry
80818             CDS       T01001                                 

Gene name
ZNF436, ZNF, Zfp46
Definition
(RefSeq) zinc finger protein 436
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    80818 (ZNF436)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    80818 (ZNF436)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    80818 (ZNF436)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_jaz Zn-ribbon_8 zinc_ribbon_15 zf_UBZ zf-C2H2_11 zf-met C1_4
Motif
Other DBs
NCBI-GeneID: 80818
NCBI-ProteinID: NP_001070663
OMIM: 611703
HGNC: 20814
Ensembl: ENSG00000125945
Vega: OTTHUMG00000003232
Pharos: Q9C0F3(Tbio)
UniProt: Q9C0F3 A0A024RAF3
LinkDB All DBs
Position
1p36.12
AA seq 470 aa AA seqDB search
MAATLLMAGSQAPVTFEDMAMYLTREEWRPLDAAQRDLYRDVMQENYGNVVSLDFEIRSE
NEVNPKQEISEDVQFGTTSERPAENAEENPESEEGFESGDRSERQWGDLTAEEWVSYPLQ
PVTDLLVHKEVHTGIRYHICSHCGKAFSQISDLNRHQKTHTGDRPYKCYECGKGFSRSSH
LIQHQRTHTGERPYDCNECGKSFGRSSHLIQHQTIHTGEKPHKCNECGKSFCRLSHLIQH
QRTHSGEKPYECEECGKSFSRSSHLAQHQRTHTGEKPYECNECGRGFSERSDLIKHYRVH
TGERPYKCDECGKNFSQNSDLVRHRRAHTGEKPYHCNECGENFSRISHLVQHQRTHTGEK
PYECNACGKSFSRSSHLITHQKIHTGEKPYECNECWRSFGERSDLIKHQRTHTGEKPYEC
VQCGKGFTQSSNLITHQRVHTGEKPYECTECEKSFSRSSALIKHKRVHTD
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaccctgctcatggctgggtcccaggcacctgtgacgtttgaagatatggcc
atgtatctcacccgggaagaatggagacctctggacgctgcacagagggacctttaccgg
gatgttatgcaggagaattatggaaatgttgtctcactagattttgagatcaggagtgag
aacgaggtaaatcccaagcaagagattagtgaagatgtacaatttgggactacatctgaa
agacctgctgagaatgctgaggaaaatcctgaaagtgaagagggctttgaaagcggagat
aggtcagaaagacaatggggagatttaacagcagaagagtgggtaagctatcctctccaa
ccagtcactgatctacttgtccacaaagaagtccacacaggcatccgctatcatatatgt
tctcattgtggaaaggccttcagtcagatctcagaccttaatcgacatcagaagacccac
actggagacagaccctataaatgttatgaatgtggaaaaggcttcagtcgcagctcacac
cttattcagcatcaaagaacacatactggggagaggccttatgactgtaacgagtgtggg
aaaagttttggaagaagttctcacctgattcagcatcagacaatccacactggagagaag
cctcacaaatgtaatgagtgtggaaaaagtttctgccgtctctctcacctaatccaacac
caaaggacccacagtggtgagaaaccctatgagtgtgaggagtgtgggaaaagcttcagc
cggagctctcacctagctcagcaccagaggacccacacgggtgagaaaccttatgaatgt
aacgaatgtggccgaggcttcagtgagagatctgatctcatcaaacactatcgagtccac
acaggggagaggccctacaagtgtgatgagtgtgggaagaatttcagtcagaactccgac
cttgtgcgtcatcgcagagcccacacgggagagaagccataccactgtaacgaatgtggg
gaaaatttcagccgcatctcacacttggttcagcaccagagaactcacactggagagaag
ccatatgaatgcaatgcttgtgggaaaagcttcagccggagctctcatctcatcacacac
cagaaaattcacactggagagaagccttatgagtgtaatgagtgttggcgaagctttggt
gaaaggtcagatctaattaaacatcagagaacccacacaggggagaagccctacgagtgt
gtgcagtgtgggaaaggtttcacccagagctccaacctcatcacacatcaaagagttcac
acgggagagaaaccttatgaatgtaccgaatgtgagaagagtttcagcaggagctcagct
cttattaaacataagagagttcatacggactaa

DBGET integrated database retrieval system