KEGG   Homo sapiens (human): 8092
Entry
8092              CDS       T01001                                 

Gene name
ALX1, CART1, FND3, HEL23
Definition
(RefSeq) ALX homeobox 1
  KO
K09334  cartilage homeoprotein 1
Organism
hsa  Homo sapiens (human)
Disease
H00528  Frontonasal dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    8092 (ALX1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    8092 (ALX1)
SSDB
Motif
Pfam: Homeodomain OAR Homeobox_KN
Other DBs
NCBI-GeneID: 8092
NCBI-ProteinID: NP_008913
OMIM: 601527
HGNC: 1494
Ensembl: ENSG00000180318
Vega: OTTHUMG00000169820
Pharos: Q15699(Tbio)
UniProt: Q15699 V9HWA7
LinkDB
Position
12q21.31
AA seq 326 aa
MEFLSEKFALKSPPSKNSDFYMGAGGPLEHVMETLDNESFYSKASAGKCVQAFGPLPRAE
HHVRLERTSPCQDSSVNYGITKVEGQPLHTELNRAMDNCNSLRMSPVKGMQEKGELDELG
DKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWF
QNRRAKWRKRERYGQIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGNASGGSVVTSCM
LPRDTSSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNFFTDSLLTGATNGHAFETKPE
FERRSSSIAVLRMKAKEHTANISWAM
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagtttctgagcgagaagtttgccctcaagagccctccgagtaaaaacagtgacttt
tacatgggcgcaggaggtcctctggagcacgttatggagacgctggacaatgagtccttt
tacagcaaagcgtctgcaggcaaatgcgtgcaggccttcggacccctgccccgcgccgag
catcacgtgcgcttggagaggacctcgccctgtcaggacagcagcgtgaactatgggatc
actaaagtagaaggacagccccttcacaccgaactgaatagagctatggacaactgtaac
agtctccgaatgtctcccgtgaaagggatgcaagagaagggagagctggatgaacttggg
gataaatgtgatagcaatgtatccagcagtaagaaacggaggcaccgaaccaccttcacc
agtttgcagctagaggagctggagaaagtctttcagaaaactcattacccggatgtgtat
gtcagagaacagcttgctctgaggacagagctcactgaggccagggtccaggtttggttt
caaaatcgaagggccaaatggagaaaaagggaacgttatggccaaatacaacaagcgaaa
agccattttgctgccacctatgatatatcagttttgccaaggactgacagctacccacag
attcagaacaatttgtgggcaggaaatgcaagtggtggttctgtggttacttcatgcatg
ttaccacgtgacacttcctcctgtatgacaccttattctcactcgcctcggacagattcc
agttacacggggttttcaaaccaccagaaccagttcagccacgtgcccctcaacaatttt
ttcactgactctcttcttactggggcaaccaatggacatgcatttgaaacaaagccagag
tttgaaaggaggtcttccagtatcgcagttcttcgaatgaaagccaaggagcacaccgcc
aatatttcatgggccatgtaa

DBGET integrated database retrieval system