KEGG   Homo sapiens (human): 81027
Entry
81027             CDS       T01001                                 

Gene name
TUBB1
Definition
(RefSeq) tubulin beta 1 class VI
  KO
K07375  tubulin beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04540  Gap junction
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05130  Pathogenic Escherichia coli infection
Network
nt06419  Microtubule-based transport
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N00978  Anterograde axonal transport
N00979  Mutation-caused aberrant Htt to anterograde axonal transport
N01018  Mutation-caused aberrant Abeta to anterograde axonal transport
N01055  Mutation-caused aberrant SNCA to anterograde axonal transport
N01158  Mutation-caused aberrant DCTN1 to retrograde axonal transport
Disease
H01740  Macrothrombocytopenia
Drug target
Avanbulin: D11681
Batabulin (DG01412): D03059 D06560
Brentuximab vedotin: D09587<JP/US>
Cabazitaxel (DG00695): D09755 D10452<JP/US>
Cevipabulin (DG01413): D06576 D08889
Colchicine: D00570<JP/US>
Denintuzumab mafodotin: D11232
Docetaxel (DG00694): D02165<JP/US> D07866<JP/US>
Enfortumab vedotin: D11525<US>
Eribulin: D08914<JP/US>
Estramustine (DG00724): D02398 D04066 D06397<JP/US>
Glembatumumab vedotin: D09912
Indibulin: D10013
Ixabepilone: D04645<US>
Lexibulin: D10073
Lifastuzumab vedotin: D11238
Lisavanbulin: D11494
Maytansine: D04864
Mivobulin isethionate: D05062
Paclitaxel: D00491<JP/US>
Paclitaxel poliglumex: D05333
Podophyllotoxin: D05529<US>
Soblidotin: D01919
Taltobulin: D06001
Tasidotin hydrochloride: D06009
Trastuzumab emtansine: D09980<JP/US>
Verubulin (DG01411): D10029 D10030
Vinblastine (DG00689): D01068<JP/US> D08675
Vincristine (DG00690): D02197<JP/US> D08679
Vindesine (DG00691): D01769<JP> D06304
Vinepidine sulfate: D06305
Vinflunine: D09032
Vinglycinate sulfate: D06306
Vinleurosine sulfate: D06307
Vinorelbine (DG00692): D01935<JP/US> D08680
Vinrosidine sulfate: D06308
Vinzolidine sulfate: D06309
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    81027 (TUBB1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    81027 (TUBB1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    81027 (TUBB1)
   05012 Parkinson disease
    81027 (TUBB1)
   05014 Amyotrophic lateral sclerosis
    81027 (TUBB1)
   05016 Huntington disease
    81027 (TUBB1)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    81027 (TUBB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    81027 (TUBB1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    81027 (TUBB1)
   04147 Exosome [BR:hsa04147]
    81027 (TUBB1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     81027 (TUBB1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    81027 (TUBB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   81027 (TUBB1)
  Exosomal proteins of colorectal cancer cells
   81027 (TUBB1)
  Exosomal proteins of bladder cancer cells
   81027 (TUBB1)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_2 Tubulin_3
Other DBs
NCBI-GeneID: 81027
NCBI-ProteinID: NP_110400
OMIM: 612901
HGNC: 16257
Ensembl: ENSG00000101162
Vega: OTTHUMG00000032860
Pharos: Q9H4B7(Tclin)
UniProt: Q9H4B7
LinkDB
Position
20q13.32
AA seq 451 aa
MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLERISVYYNEAYGRKYV
PRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVV
RHESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSDTVV
EPYNAVLSIHQLIENADACFCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGITTSL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQYRALSVAELTQQMFDARNTM
AACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVKVAVCDIPPRG
LSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVS
EYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgcgtgaaattgtccatattcagattggccagtgtggcaaccagatcggagccaagttc
tgggagatgattggtgaggaacacgggatcgacttggctgggagcgaccgcggggcctcg
gccttgcagctggagagaatcagcgtgtactacaacgaagcctacggtaggaaatatgtg
ccccgagcagtcttggtggacctagaacctgggacgatggacagcattcgatctagcaaa
ttaggagctctctttcaacccgacagttttgtccatggtaactctggggctggcaacaac
tgggccaaaggccactacacggagggagccgagctgatcgagaatgtcctagaggtggtg
aggcacgagagtgagagctgtgactgcctgcagggcttccagatcgtccactccctgggc
gggggcacaggctccgggatgggcactctgctcatgaacaagattagagaggagtacccg
gaccggatcatgaattccttcagcgtcatgccttctcccaaggtgtcggacactgtggtg
gagccctacaacgcggttctgtctatccaccagctgattgagaatgcagatgcctgtttc
tgcattgacaatgaggccctctatgacatctgcttccgtaccctgaagctgacgacaccc
acctatggggatctcaaccacctagtgtccttgaccatgagcggcataaccacctccctc
cggttcccgggtcagctcaacgcagacctgcgcaagctggcggtgaacatggtccccttc
ccccgcctgcacttctttatgcccggctttgccccactcacggcccagggcagccagcag
taccgagccctctccgtggccgagctcacccagcagatgttcgatgcccgcaataccatg
gctgcctgtgacctccgccgtggccgctacctcacagtggcctgcattttccggggcaag
atgtccaccaaggaagtggaccagcaactgctctccgtgcagaccaggaacagcagctgc
tttgtggagtggattcccaacaacgtcaaggtggctgtctgcgacatcccgccccggggg
ctgagcatggccgccaccttcattggcaacaacacggccatccaagagatctttaatagg
gtctctgagcatttctcagccatgttcaaaaggaaagcttttgtgcactggtacaccagc
gaagggatggacataaacgaatttggggaagctgaaaataacatccatgatttggtatcc
gagtaccaacaatttcaagatgccaaagcagttctagaggaagatgaagaggtcacggag
gaggcagaaatggagccagaagataagggacattaa

DBGET integrated database retrieval system