KEGG   Homo sapiens (human): 811Help
Entry
811               CDS       T01001                                 

Gene name
CALR, CRT, HEL-S-99n, RO, SSA, cC1qR
Definition
(RefSeq) calreticulin
  KO
K08057  calreticulin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04145  Phagosome
hsa04612  Antigen processing and presentation
hsa05142  Chagas disease (American trypanosomiasis)
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06120  Calcium signaling (viruses)
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06220  Calcium signaling
nt06229  MHC presentation
  Element
N00363  Antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
N00479  EBV BNLF2a to antigen processing and presentation by MHC class I molecules
N00490  HTLV-1 p12 to calcineurin signaling pathway
N00581  HSV ICP47 to antigen processing and presentation by MHC class I molecules
Disease
H01605  Myelofibrosis
H01612  Essential thrombocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    811 (CALR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    811 (CALR)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    811 (CALR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    811 (CALR)
   05170 Human immunodeficiency virus 1 infection
    811 (CALR)
   05168 Herpes simplex virus 1 infection
    811 (CALR)
   05163 Human cytomegalovirus infection
    811 (CALR)
   05169 Epstein-Barr virus infection
    811 (CALR)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    811 (CALR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    811 (CALR)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    811 (CALR)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   811 (CALR)
Lectins [BR:hsa04091]
 Calnexin / calreticulin
  811 (CALR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calreticulin
Motif
Other DBs
NCBI-GeneID: 811
NCBI-ProteinID: NP_004334
OMIM: 109091
HGNC: 1455
Ensembl: ENSG00000179218
Vega: OTTHUMG00000180574
Pharos: P27797(Tbio)
UniProt: P27797 V9HW88
LinkDB All DBs
Structure
PDB: 

Position
19p13.13
AA seq 417 aa AA seqDB search
MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDE
EKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQT
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgctgctatccgtgccgctgctgctcggcctcctcggcctggccgtcgccgagcctgcc
gtctacttcaaggagcagtttctggacggagacgggtggacttcccgctggatcgaatcc
aaacacaagtcagattttggcaaattcgttctcagttccggcaagttctacggtgacgag
gagaaagataaaggtttgcagacaagccaggatgcacgcttttatgctctgtcggccagt
ttcgagcctttcagcaacaaaggccagacgctggtggtgcagttcacggtgaaacatgag
cagaacatcgactgtgggggcggctatgtgaagctgtttcctaatagtttggaccagaca
gacatgcacggagactcagaatacaacatcatgtttggtcccgacatctgtggccctggc
accaagaaggttcatgtcatcttcaactacaagggcaagaacgtgctgatcaacaaggac
atccgttgcaaggatgatgagtttacacacctgtacacactgattgtgcggccagacaac
acctatgaggtgaagattgacaacagccaggtggagtccggctccttggaagacgattgg
gacttcctgccacccaagaagataaaggatcctgatgcttcaaaaccggaagactgggat
gagcgggccaagatcgatgatcccacagactccaagcctgaggactgggacaagcccgag
catatccctgaccctgatgctaagaagcccgaggactgggatgaagagatggacggagag
tgggaacccccagtgattcagaaccctgagtacaagggtgagtggaagccccggcagatc
gacaacccagattacaagggcacttggatccacccagaaattgacaaccccgagtattct
cccgatcccagtatctatgcctatgataactttggcgtgctgggcctggacctctggcag
gtcaagtctggcaccatctttgacaacttcctcatcaccaacgatgaggcatacgctgag
gagtttggcaacgagacgtggggcgtaacaaaggcagcagagaaacaaatgaaggacaaa
caggacgaggagcagaggcttaaggaggaggaagaagacaagaaacgcaaagaggaggag
gaggcagaggacaaggaggatgatgaggacaaagatgaggatgaggaggatgaggaggac
aaggaggaagatgaggaggaagatgtccccggccaggccaaggacgagctgtag

KEGG   Homo sapiens (human): 821Help
Entry
821               CDS       T01001                                 

Gene name
CANX, CNX, IP90, P90
Definition
(RefSeq) calnexin
  KO
K08054  calnexin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04145  Phagosome
hsa04612  Antigen processing and presentation
hsa04918  Thyroid hormone synthesis
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06120  Calcium signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06220  Calcium signaling
  Element
N00490  HTLV-1 p12 to calcineurin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    821 (CANX)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    821 (CANX)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    821 (CANX)
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    821 (CANX)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    821 (CANX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    821 (CANX)
   04131 Membrane trafficking [BR:hsa04131]
    821 (CANX)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    821 (CANX)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   821 (CANX)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    821 (CANX)
Lectins [BR:hsa04091]
 Calnexin / calreticulin
  821 (CANX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calreticulin Connexin FAM176 MAP17 TRAP_alpha V_ATPase_I
Motif
Other DBs
NCBI-GeneID: 821
NCBI-ProteinID: NP_001019820
OMIM: 114217
HGNC: 1473
Ensembl: ENSG00000127022
Vega: OTTHUMG00000130910
Pharos: P27824(Tbio)
UniProt: P27824
LinkDB All DBs
Position
5q35.3
AA seq 592 aa AA seqDB search
MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTY
KAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGL
VLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFH
DKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTL
ILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVK
PDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRC
ESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFS
AIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEER
PWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDE
EEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggaagggaagtggttgctgtgtatgttactggtgcttggaactgctattgttgaggct
catgatggacatgatgatgatgtgattgatattgaggatgaccttgacgatgtcattgaa
gaggtagaagactcaaaaccagataccactgctcctccttcatctcccaaggttacttac
aaagctccagttccaacaggggaagtatattttgctgattcttttgacagaggaactctg
tcagggtggattttatccaaagccaagaaagacgataccgatgatgaaattgccaaatat
gatggaaagtgggaggtagaggaaatgaaggagtcaaagcttccaggtgataaaggactt
gtgttgatgtctcgggccaagcatcatgccatctctgctaaactgaacaagcccttcctg
tttgacaccaagcctctcattgttcagtatgaggttaatttccaaaatggaatagaatgt
ggtggtgcctatgtgaaactgctttctaaaacaccagaactcaacctggatcagttccat
gacaagaccccttatacgattatgtttggtccagataaatgtggagaggactataaactg
cacttcatcttccgacacaaaaaccccaaaacgggtatctatgaagaaaaacatgctaag
aggccagatgcagatctgaagacctattttactgataagaaaacacatctttacacacta
atcttgaatccagataatagttttgaaatactggttgaccaatctgtggtgaatagtgga
aatctgctcaatgacatgactcctcctgtaaatccttcacgtgaaattgaggacccagaa
gaccggaagcccgaggattgggatgaaagaccaaaaatcccagatccagaagctgtcaag
ccagatgactgggatgaagatgcccctgctaagattccagatgaagaggccacaaaaccc
gaaggctggttagatgatgagcctgagtacgtacctgatccagacgcagagaaacctgag
gattgggatgaagacatggatggagaatgggaggctcctcagattgccaaccctagatgt
gagtcagctcctggatgtggtgtctggcagcgacctgtgattgacaaccccaattataaa
ggcaaatggaagcctcctatgattgacaatcccagttaccagggaatctggaaacccagg
aaaataccaaatccagatttctttgaagatctggaacctttcagaatgactccttttagt
gctattggtttggagctgtggtccatgacctctgacattttttttgacaactttatcatt
tgtgctgatcgaagaatagttgatgattgggccaatgatggatggggcctgaagaaagct
gctgatggggctgctgagccaggcgttgtggggcagatgatcgaggcagctgaagagcgc
ccgtggctgtgggtagtctatattctaactgtagcccttcctgtgttcctggttatcctc
ttctgctgttctggaaagaaacagaccagtggtatggagtataagaaaactgatgcacct
caaccggatgtgaaggaagaggaagaagagaaggaagaggaaaaggacaagggagatgag
gaggaggaaggagaagagaaacttgaagagaaacagaaaagtgatgctgaagaagatggt
ggcactgtcagtcaagaggaggaagacagaaaacctaaagcagaggaggatgaaattttg
aacagatcaccaagaaacagaaagccacgaagagagtga

DBGET integrated database retrieval system