KEGG   Homo sapiens (human): 8128
Entry
8128              CDS       T01001                                 

Gene name
ST8SIA2, HsT19690, SIAT8-B, SIAT8B, ST8SIA-II, ST8SiaII, STX
Definition
(RefSeq) ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2
  KO
K06612  alpha-N-acetyl-neuraminate alpha-2,8-sialyltransferase (sialyltransferase 8B) [EC:2.4.99.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    8128 (ST8SIA2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.-  
     8128 (ST8SIA2)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   8128 (ST8SIA2)
SSDB
Motif
Pfam: Glyco_transf_29
Other DBs
NCBI-GeneID: 8128
NCBI-ProteinID: NP_006002
OMIM: 602546
HGNC: 10870
Ensembl: ENSG00000140557
Vega: OTTHUMG00000149843
Pharos: Q92186(Tbio)
UniProt: Q92186 B2R9U8
LinkDB
Position
15q26.1
AA seq 375 aa
MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVIN
GSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPG
DIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFGTCAIVGNSGVLLNSGCGQEIDAHSF
VIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHSLNGSILWI
PAFMARGGKERVEWVNELILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMY
TLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPLEFKALKSLHE
QGALKLTVGQCDGAT
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgcagctgcagttccggagctggatgctggccgcgctcacgctgctcgtggtcttcctc
atcttcgcagacatctcagagatcgaagaagaaatcgggaattcgggaggcagaggtaca
atcagatcagctgtgaacagcttacatagcaaatctaatagagctgaagttgtaataaac
ggctcctcatcaccagctgttgttgacagaagtaatgaaagcatcaagcacaacatccag
ccagcctcgtccaaatggagacataaccagacgctctctctgaggatcaggaagcagatt
ttaaagttcttggatgctgaaaaggacatttctgtcctaaagggaaccctgaagcctgga
gatattattcattacatcttcgatcgagacagcaccatgaatgtgtcccagaacctctac
gagctcctccccaggacttcgccactgaagaataagcactttgggacttgtgccatcgtg
ggcaactcgggggtcttgctgaacagcggctgtgggcaggagattgacgcccacagcttc
gtcatcaggtgcaacctggccccagtacaggagtatgcccgggatgtggggctcaagaca
gacctggtaaccatgaacccctcggtcatccagcgggcctttgaggacttggtcaatgcc
acgtggcgggagaagctgctgcaacggctgcacagcctcaatggcagcatcctgtggatc
cctgccttcatggcccggggcggcaaggagcgtgttgagtgggtcaacgagcttatcctg
aagcaccacgtcaacgtgcgcactgcatacccctcgctgcgcctgctgcacgccgttcgc
ggatactggctgaccaacaaagtccacatcaaaagacccaccaccggcctcttgatgtat
accctggccacacgtttctgcaaacaaatctacctctacggcttctggccctttccgctg
gatcagaaccagaacccagtcaagtaccactattatgacagcctcaagtatggctacacc
tcccaggccagcccgcataccatgcccttggagtttaaggccctcaagagcctacatgag
cagggggctttgaaactgactgtcggccagtgcgatggggccacgtag

DBGET integrated database retrieval system