KEGG   Homo sapiens (human): 8140Help
Entry
8140              CDS       T01001                                 

Gene name
SLC7A5, 4F2LC, CD98, D16S469E, E16, LAT1, MPE16
Definition
(RefSeq) solute carrier family 7 member 5
  KO
K13780  solute carrier family 7 (L-type amino acid transporter), member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    8140 (SLC7A5)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    8140 (SLC7A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    8140 (SLC7A5)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   8140 (SLC7A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease_2 AA_permease
Motif
Other DBs
NCBI-GeneID: 8140
NCBI-ProteinID: NP_003477
OMIM: 600182
HGNC: 11063
Ensembl: ENSG00000103257
Vega: OTTHUMG00000137658
Pharos: Q01650(Tbio)
UniProt: Q01650
LinkDB All DBs
Structure
PDB: 

Position
16q24.2
AA seq 507 aa AA seqDB search
MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNITLLNGVAIIV
GTIIGSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYM
LEVYGSLPAFLKLWIELLIIRPSSQYIVALVFATYLLKPLFPTCPVPEEAAKLVACLCVL
LLTAVNCYSVKAATRVQDAFAAAKLLALALIILLGFVQIGKGDVSNLDPNFSFEGTKLDV
GNIVLALYSGLFAYGGWNYLNFVTEEMINPYRNLPLAIIISLPIVTLVYVLTNLAYFTTL
STEQMLSSEAVAVDFGNYHLGVMSWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLP
SILSMIHPQLLTPVPSLVFTCVMTLLYAFSKDIFSVINFFSFFNWLCVALAIIGMIWLRH
RKPELERPIKVNLALPVFFILACLFLIAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKN
KPKWLLQGIFSTTVLCQKLMQVVPQET
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtgcgggcccgaagcggcgcgcgctagcggcgccggcggccgaggagaaggaa
gaggcgcgggagaagatgctggccgccaagagcgcggacggctcggcgccggcaggcgag
ggcgagggcgtgaccctgcagcggaacatcacgctgctcaacggcgtggccatcatcgtg
gggaccattatcggctcgggcatcttcgtgacgcccacgggcgtgctcaaggaggcaggc
tcgccggggctggcgctggtggtgtgggccgcgtgcggcgtcttctccatcgtgggcgcg
ctctgctacgcggagctcggcaccaccatctccaaatcgggcggcgactacgcctacatg
ctggaggtctacggctcgctgcccgccttcctcaagctctggatcgagctgctcatcatc
cggccttcatcgcagtacatcgtggccctggtcttcgccacctacctgctcaagccgctc
ttccccacctgcccggtgcccgaggaggcagccaagctcgtggcctgcctctgcgtgctg
ctgctcacggccgtgaactgctacagcgtgaaggccgccacccgggtccaggatgccttt
gccgccgccaagctcctggccctggccctgatcatcctgctgggcttcgtccagatcggg
aagggtgatgtgtccaatctagatcccaacttctcatttgaaggcaccaaactggatgtg
gggaacattgtgctggcattatacagcggcctctttgcctatggaggatggaattacttg
aatttcgtcacagaggaaatgatcaacccctacagaaacctgcccctggccatcatcatc
tccctgcccatcgtgacgctggtgtacgtgctgaccaacctggcctacttcaccaccctg
tccaccgagcagatgctgtcgtccgaggccgtggccgtggacttcgggaactatcacctg
ggcgtcatgtcctggatcatccccgtcttcgtgggcctgtcctgcttcggctccgtcaat
gggtccctgttcacatcctccaggctcttcttcgtggggtcccgggaaggccacctgccc
tccatcctctccatgatccacccacagctcctcacccccgtgccgtccctcgtgttcacg
tgtgtgatgacgctgctctacgccttctccaaggacatcttctccgtcatcaacttcttc
agcttcttcaactggctctgcgtggccctggccatcatcggcatgatctggctgcgccac
agaaagcctgagcttgagcggcccatcaaggtgaacctggccctgcctgtgttcttcatc
ctggcctgcctcttcctgatcgccgtctccttctggaagacacccgtggagtgtggcatc
ggcttcaccatcatcctcagcgggctgcccgtctacttcttcggggtctggtggaaaaac
aagcccaagtggctcctccagggcatcttctccacgaccgtcctgtgtcagaagctcatg
caggtggtcccccaggagacatag

DBGET integrated database retrieval system