KEGG   Homo sapiens (human): 81671
Entry
81671             CDS       T01001                                 

Gene name
VMP1, EPG3, TANGO5, TMEM49
Definition
(RefSeq) vacuole membrane protein 1
  KO
K21248  vacuole membrane protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    81671 (VMP1)
SSDB
Motif
Pfam: SNARE_assoc
Other DBs
NCBI-GeneID: 81671
NCBI-ProteinID: NP_001316323
OMIM: 611753
HGNC: 29559
Ensembl: ENSG00000062716
Vega: OTTHUMG00000179882
Pharos: Q96GC9(Tbio)
UniProt: Q96GC9
LinkDB
Position
17q23.1
AA seq 406 aa
MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQYFSLE
ILVILKEWTSKLWHRQSIVVSFLLLLAVLIATYYVEGVHQQYVQRIEKQFLLYAYWIGLG
ILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGTISL
WSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAESAQDF
ASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIK
MHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQG
ENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcagagaatggaaaaaattgtgaccagagacgtgtagcaatgaacaaggaacatcat
aatggaaatttcacagacccctcttcagtgaatgaaaagaagaggagggagcgggaagaa
aggcagaatattgtcctgtggagacagccgctcattaccttgcagtatttttctctggaa
atccttgtaatcttgaaggaatggacctcaaaattatggcatcgtcaaagcattgtggtg
tcttttttactgctgcttgctgtgcttatagctacgtattatgttgaaggagtgcatcaa
cagtatgtgcaacgtatagagaaacagtttcttttgtatgcctactggataggcttagga
attttgtcttctgttgggcttggaacagggctgcacacctttctgctttatctgggtcca
catatagcctcagttacattagctgcttatgaatgcaattcagttaattttcccgaacca
ccctatcctgatcagattatttgtccagatgaagagggcactgaaggaaccatttctttg
tggagtatcatctcaaaagttaggattgaagcctgcatgtggggtatcggtacagcaatc
ggagagctgcctccatatttcatggccagagcagctcgcctctcaggtgctgaaccagat
gatgaagagtatcaggaatttgaagagatgctggaacatgcagagtctgcacaagacttt
gcctcccgggccaaactggcagttcaaaaactagtacagaaagttggattttttggaatt
ttggcctgtgcttcaattccaaatcctttatttgatctggctggaataacgtgtggacac
tttctggtacctttttggaccttctttggtgcaaccctaattggaaaagcaataataaaa
atgcatatccagaaaatttttgttataataacattcagcaagcacatagtggagcaaatg
gtggctttcattggtgctgtccccggcataggtccatctctgcagaagccatttcaggag
tacctggaggctcaacggcagaagcttcaccacaaaagcgaaatgggcacaccacaggga
gaaaactggttgtcctggatgtttgaaaagttggtcgttgtcatggtgtgttacttcatc
ctatctatcattaactccatggcacaaagttatgccaaacgaatccagcagcggttgaac
tcagaggagaaaactaaataa

DBGET integrated database retrieval system