KEGG   Homo sapiens (human): 81788Help
Entry
81788             CDS       T01001                                 

Gene name
NUAK2, SNARK
Definition
(RefSeq) NUAK family kinase 2
  KO
K08800  NUAK family, SNF1-like kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    81788 (NUAK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     81788 (NUAK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   81788 (NUAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like RIO1 Kdo APH
Motif
Other DBs
NCBI-GeneID: 81788
NCBI-ProteinID: NP_112214
OMIM: 608131
HGNC: 29558
Ensembl: ENSG00000163545
Vega: OTTHUMG00000037196
Pharos: Q9H093(Tchem)
UniProt: Q9H093 B4E0Y5
LinkDB All DBs
Position
1q32.1
AA seq 628 aa AA seqDB search
MESLVFARRSGPTPSAAELARPLAEGLIKSPKPLMKKQAVKRHHHKHNLRHRYEFLETLG
KGTYGKVKKARESSGRLVAIKSIRKDKIKDEQDLMHIRREIEIMSSLNHPHIIAIHEVFE
NSSKIVIVMEYASRGDLYDYISERQQLSEREARHFFRQIVSAVHYCHQNRVVHRDLKLEN
ILLDANGNIKIADFGLSNLYHQGKFLQTFCGSPLYASPEIVNGKPYTGPEVDSWSLGVLL
YILVHGTMPFDGHDHKILVKQISNGAYREPPKPSDACGLIRWLLMVNPTRRATLEDVASH
WWVNWGYATRVGEQEAPHEGGHPGSDSARASMADWLRRSSRPLLENGAKVCSFFKQHAPG
GGSTTPGLERQHSLKKSRKENDMAQSLHSDTADDTAHRPGKSNLKLPKGILKKKVSASAE
GVQEDPPELSPIPASPGQAAPLLPKKGILKKPRQRESGYYSSPEPSESGELLDAGDVFVS
GDPKEQKPPQASGLLLHRKGILKLNGKFSQTALELAAPTTFGSLDELAPPRPLARASRPS
GAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPL
GDSCFSLTDCQEVTATYRQALRVCSKLT
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgctggttttcgcgcggcgctccggccccactccctcggccgcagagctagcc
cggccgctggcggaagggctgatcaagtcgcccaagcccctaatgaagaagcaggcggtg
aagcggcaccaccacaagcacaacctgcggcaccgctacgagttcctggagaccctgggc
aaaggcacctacgggaaggtgaagaaggcgcgggagagctcggggcgcctggtggccatc
aagtcaatccggaaggacaaaatcaaagatgagcaagatctgatgcacatacggagggag
attgagatcatgtcatcactcaaccaccctcacatcattgccatccatgaagtgtttgag
aacagcagcaagatcgtgatcgtcatggagtatgccagccggggcgacctttatgactac
atcagcgagcggcagcagctcagtgagcgcgaagctaggcatttcttccggcagatcgtc
tctgccgtgcactattgccatcagaacagagttgtccaccgagatctcaagctggagaac
atcctcttggatgccaatgggaatatcaagattgctgacttcggtctctccaacctctac
catcaaggcaagttcctgcagacattctgtgggagccccctctatgcctcgccagagatt
gtcaatgggaagccctacacaggcccagaggtggacagctggtccctgggtgttctcctc
tacatcctggtgcatggcaccatgccctttgatgggcatgaccataagatcctagtgaaa
cagatcagcaacggggcctaccgggagccacctaaaccctctgatgcctgtggcctgatc
cggtggctgttgatggtgaaccccacccgccgggccaccctggaggatgtggccagtcac
tggtgggtcaactggggctacgccacccgagtgggagagcaggaggctccgcatgagggt
gggcaccctggcagtgactctgcccgcgcctccatggctgactggctccggcgttcctcc
cgccccctcctggagaatggggccaaggtgtgcagcttcttcaagcagcatgcacctggt
gggggaagcaccacccctggcctggagcgccagcattcgctcaagaagtcccgcaaggag
aatgacatggcccagtctctccacagtgacacggctgatgacactgcccatcgccctggc
aagagcaacctcaagctgccaaagggcattctcaagaagaaggtgtcagcctctgcagaa
ggggtacaggaggaccctccggagctcagcccaatccctgcgagcccagggcaggctgcc
cccctgctccccaagaagggcattctcaagaagccccgacagcgcgagtctggctactac
tcctctcccgagcccagtgaatctggggagctcttggacgcaggcgacgtgtttgtgagt
ggggatcccaaggagcagaagcctccgcaagcttcagggctgctcctccatcgcaaaggc
atcctcaaactcaatggcaagttctcccagacagccttggagctcgcggcccccaccacc
ttcggctccctggatgaactcgccccacctcgccccctggcccgggccagccgaccctca
ggggctgtgagcgaggacagcatcctgtcctctgagtcctttgaccagctggacttgcct
gaacggctcccagagcccccactgcggggctgtgtgtctgtggacaacctcacggggctt
gaggagcccccctcagagggccctggaagctgcctgaggcgctggcggcaggatcctttg
ggggacagctgcttttccctgacagactgccaggaggtgacagcgacctaccgacaggca
ctgagggtctgctcaaagctcacctga

DBGET integrated database retrieval system