KEGG   Homo sapiens (human): 8228
Entry
8228              CDS       T01001                                 

Gene name
PNPLA4, DXS1283E, GS2, iPLA2eta
Definition
(RefSeq) patatin like phospholipase domain containing 4
  KO
K11157  patatin-like phospholipase domain-containing protein 4 [EC:3.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    8228 (PNPLA4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     8228 (PNPLA4)
SSDB
Motif
Pfam: Patatin
Other DBs
NCBI-GeneID: 8228
NCBI-ProteinID: NP_001135861
OMIM: 300102
HGNC: 24887
Ensembl: ENSG00000006757
Vega: OTTHUMG00000021103
Pharos: P41247(Tbio)
UniProt: P41247 A0A024RBU8
LinkDB
Position
Xp22.31
AA seq 253 aa
MKHINLSFAACGFLGIYHLGAASALCRHGKKLVKDVKAFAGASAGSLVASVLLTAPEKIE
ECNQFTYKFAEEIRRQSFGAVTPGYDFMARLRSGMESILPPSAHELAQNRLHVSITNAKT
RENHLVSTFSSREDLIKVLLASSFVPIYAGLKLVEYKGQKWVDGGLTNALPILPVGRTVT
ISPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKMESLYQCGFD
DTVKFLLKENWFE
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaagcacatcaacctatcatttgcagcgtgtggatttctgggcatttaccacttgggg
gcagcatctgcactttgcagacatggcaaaaaacttgtgaaggatgtcaaagccttcgct
ggggcgtctgcgggatcgttggttgcttctgttctgctaacagcaccagaaaaaatagag
gaatgtaaccaatttacctacaagtttgccgaagaaatcagaaggcagtctttcggggca
gtaacgcccggttatgacttcatggcccgactaagaagtgggatggagtcgattcttcct
cccagcgctcacgagctggcccagaaccgactgcacgtatccatcaccaacgccaaaacc
agagaaaatcacttagtctccactttttcctccagggaggacctcattaaggtcctccta
gccagcagttttgtgcccatttatgcaggactgaagctagtggaatacaaagggcagaag
tgggtggacggaggcctcaccaacgctcttcccatcctgcccgtcggccggacagtaacc
atctcccccttcagtggacgactggacatctccccgcaggacaaagggcagctagatctg
tatgttaatatcgccaagcaggatatcatgttgtccctggcaaacctggtgagactcaac
caagccctttttcccccaagcaagaggaaaatggaatctttgtatcagtgtggttttgat
gacactgttaagtttttacttaaagaaaattggtttgaataa

DBGET integrated database retrieval system