KEGG   Homo sapiens (human): 8289
Entry
8289              CDS       T01001                                 

Gene name
ARID1A, B120, BAF250, BAF250a, BM029, C1orf4, CSS2, ELD, MRD14, OSA1, P270, SMARCF1, hELD, hOSA1
Definition
(RefSeq) AT-rich interaction domain 1A
  KO
K11653  AT-rich interactive domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04714  Thermogenesis
hsa05225  Hepatocellular carcinoma
Disease
H00048  Hepatocellular carcinoma
H00773  Autosomal dominant mental retardation
H01403  Coffin-Siris syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    8289 (ARID1A)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    8289 (ARID1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    8289 (ARID1A)
   03036 Chromosome and associated proteins [BR:hsa03036]
    8289 (ARID1A)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     8289 (ARID1A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    8289 (ARID1A)
SSDB
Motif
Pfam: BAF250_C ARID
Other DBs
NCBI-GeneID: 8289
NCBI-ProteinID: NP_006006
OMIM: 603024
HGNC: 11110
Ensembl: ENSG00000117713
Vega: OTTHUMG00000004004
Pharos: O14497(Tbio)
UniProt: O14497
LinkDB
Structure
PDB: 
1RYU

Position
1p36.11
AA seq 2285 aa
MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEG
PAVGPPQPLGKELQDGAESNGGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLTEP
PGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG
LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPG
SGAAAAAGSKPPPSSSASASSSSSSFAQQRFGAMGGGGPSAAGGGTPQPTATPTLNQLLT
SPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA
PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQ
PYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQQSPHPQQ
QQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST
TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPP
QELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGTEGALSPG
VSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVP
GNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQ
IHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGINPMGAGGQ
MHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVA
MHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAG
MAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPER
KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNL
NVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGS
MQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFNDGSDSTFQ
KRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPY
SRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYS
PSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPMDGTYGPP
AKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATAT
AATERRPAGGPQNQFPFQFGRDRVSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQG
RNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQPPYGPSAP
VPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPV
PASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGL
LAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPG
QRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAFSGKDKPASEN
SEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFE
SKTELLPSRPHAPCPPAPRKHVTTAEGTPGTTDQEGPPPDGPPEKRITATMDDMLSTRSS
TLTEDGAKSSEAIKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKR
CVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQG
VSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQ
DPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKN
PVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQN
PPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLF
LIGQS
NT seq 6858 nt   +upstreamnt  +downstreamnt
atggccgcgcaggtcgcccccgccgccgccagcagcctgggcaacccgccgccgccgccg
ccctcggagctgaagaaagccgagcagcagcagcgggaggaggcggggggcgaggcggcg
gcggcggcagcggccgagcgcggggaaatgaaggcagccgccgggcaggaaagcgagggc
cccgccgtggggccgccgcagccgctgggaaaggagctgcaggacggggccgagagcaat
gggggtggcggcggcggcggagccggcagcggcggcgggcccggcgcggagccggacctg
aagaactcgaacgggaacgcgggccctaggcccgccctgaacaataacctcacggagccg
cccggcggcggcggtggcggcagcagcgatggggtgggggcgcctcctcactcagccgcg
gccgccttgccgcccccagcctacggcttcgggcaaccctacggccggagcccgtctgcc
gtcgccgccgccgcggccgccgtcttccaccaacaacatggcggacaacaaagccctggc
ctggcagcgctgcagagcggcggcggcgggggcctggagccctacgcggggccccagcag
aactctcacgaccacggcttccccaaccaccagtacaactcctactaccccaaccgcagc
gcctaccccccgcccgccccggcctacgcgctgagctccccgagaggtggcactccgggc
tccggcgcggcggcggctgccggctccaagccgcctccctcctccagcgcctccgcctcc
tcgtcgtcttcgtccttcgctcagcagcgcttcggggccatggggggaggcggcccctcc
gcggccggcgggggaactccccagcccaccgccacccccaccctcaaccaactgctcacg
tcgcccagctcggcccggggctaccagggctaccccgggggcgactacagtggcgggccc
caggacgggggcgccggcaagggcccggcggacatggcctcgcagtgttggggggctgcg
gcggcggcagctgcggcggcggccgcctcgggaggggcccaacaaaggagccaccacgcg
cccatgagccccgggagcagcggcggcggggggcagccgctcgcccggacccctcagcca
tccagtccaatggatcagatgggcaagatgagacctcagccatatggcgggactaaccca
tactcgcagcaacagggacctccgtcaggaccgcagcaaggacatgggtacccagggcag
ccatacgggtcccagaccccgcagcggtacccgatgaccatgcagggccgggcgcagagt
gccatgggcggcctctcttatacacagcagattcctccttatggacaacaaggccccagc
gggtatggtcaacagggccagactccatattacaaccagcaaagtcctcaccctcagcag
cagcagccaccctactcccagcaaccaccgtcccagacccctcatgcccaaccttcgtat
cagcagcagccacagtctcaaccaccacagctccagtcctctcagcctccatactcccag
cagccatcccagcctccacatcagcagtccccggctccatacccctcccagcagtcgacg
acacagcagcacccccagagccagcccccctactcacagccacaggctcagtctccttac
cagcagcagcaacctcagcagccagcaccctcgacgctctcccagcaggctgcgtatcct
cagccccagtctcagcagtcccagcaaactgcctattcccagcagcgcttccctccaccg
caggagctatctcaagattcatttgggtctcaggcatcctcagccccctcaatgacctcc
agtaagggagggcaagaagatatgaacctgagccttcagtcaagaccctccagcttgcct
gatctatctggttcaatagatgacctccccatggggacagaaggagctctgagtcctgga
gtgagcacatcagggatttccagcagccaaggagagcagagtaatccagctcagtctcct
ttctctcctcatacctcccctcacctgcctggcatccgaggcccttccccgtcccctgtt
ggctctcccgccagtgttgctcagtctcgctcaggaccactctcgcctgctgcagtgcca
ggcaaccagatgccacctcggccacccagtggccagtcggacagcatcatgcatccttcc
atgaaccaatcaagcattgcccaagatcgaggttatatgcagaggaacccccagatgccc
cagtacagttccccccagcccggctcagccttatctccgcgtcagccttccggaggacag
atacacacaggcatgggctcctaccagcagaactccatggggagctatggtccccagggg
ggtcagtatggcccacaaggtggctaccccaggcagccaaactataatgccttgcccaat
gccaactaccccagtgcaggcatggctggaggcataaaccccatgggtgccggaggtcaa
atgcatggacagcctggcatcccaccttatggcacactccctccagggaggatgagtcac
gcctccatgggcaaccggccttatggccctaacatggccaatatgccacctcaggttggg
tcagggatgtgtcccccaccagggggcatgaaccggaaaacccaagaaactgctgtcgcc
atgcatgttgctgccaactctatccaaaacaggccgccaggctaccccaatatgaatcaa
gggggcatgatgggaactggacctccttatggacaagggattaatagtatggctggcatg
atcaaccctcagggacccccatattccatgggtggaaccatggccaacaattctgcaggg
atggcagccagcccagagatgatgggccttggggatgtaaagttaactccagccaccaaa
atgaacaacaaggcagatgggacacccaagacagaatccaaatccaagaaatccagttct
tctactacaaccaatgagaagatcaccaagttgtatgagctgggtggtgagcctgagagg
aagatgtgggtggaccgttatctggccttcactgaggagaaggccatgggcatgacaaat
ctgcctgctgtgggtaggaaacctctggacctctatcgcctctatgtgtctgtgaaggag
attggtggattgactcaggtcaacaagaacaaaaaatggcgggaacttgcaaccaacctc
aatgtgggcacatcaagcagtgctgccagctccttgaaaaagcagtatatccagtgtctc
tatgcctttgaatgcaagattgaacggggagaagaccctcccccagacatctttgcagct
gctgattccaagaagtcccagcccaagatccagcctccctctcctgcgggatcaggatct
atgcaggggccccagactccccagtcaaccagcagttccatggcagaaggaggagactta
aagccaccaactccagcatccacaccacacagtcagatccccccattgccaggcatgagc
aggagcaattcagttgggatccaggatgcctttaatgatggaagtgactccacattccag
aagcggaattccatgactccaaaccctgggtatcagcccagtatgaatacctctgacatg
atggggcgcatgtcctatgagccaaataaggatccttatggcagcatgaggaaagctcca
gggagtgatcccttcatgtcctcagggcagggccccaacggcgggatgggtgacccctac
agtcgtgctgccggccctgggctaggaaatgtggcgatgggaccacgacagcactatccc
tatggaggtccttatgacagagtgaggacggagcctggaatagggcctgagggaaacatg
agcactggggccccacagccgaatctcatgccttccaacccagactcggggatgtattct
cctagccgctaccccccgcagcagcagcagcagcagcagcaacgacatgattcctatggc
aatcagttctccacccaaggcaccccttctggcagccccttccccagccagcagactaca
atgtatcaacagcaacagcagaattacaagcggccaatggatggcacatatggccctcct
gccaagcggcacgaaggggagatgtacagcgtgccatacagcactgggcaggggcagcct
cagcagcagcagttgcccccagcccagccccagcctgccagccagcaacaagctgcccag
ccttcccctcagcaagatgtatacaaccagtatggcaatgcctatcctgccactgccaca
gctgctactgagcgccgaccagcaggcggcccccagaaccaatttccattccagtttggc
cgagaccgtgtctctgcaccccctggcaccaatgcccagcaaaacatgccaccacaaatg
atgggcggccccatacaggcatcagctgaggttgctcagcaaggcaccatgtggcagggg
cgtaatgacatgacctataattatgccaacaggcagagcacgggctctgccccccagggc
cccgcctatcatggcgtgaaccgaacagatgaaatgctgcacacagatcagagggccaac
cacgaaggctcgtggccttcccatggcacacgccagcccccatatggtccctctgcccct
gtgccccccatgacaaggccccctccatctaactaccagcccccaccaagcatgcagaat
cacattcctcaggtatccagccctgctcccctgccccggccaatggagaaccgcacctct
cctagcaagtctccattcctgcactctgggatgaaaatgcagaaggcaggtcccccagta
cctgcctcgcacatagcacctgcccctgtgcagccccccatgattcggcgggatatcacc
ttcccacctggctctgttgaagccacacagcctgtgttgaagcagaggaggcggctcaca
atgaaagacattggaaccccggaggcatggcgggtaatgatgtccctcaagtctggtctc
ctggcagagagcacatgggcattagataccatcaacatcctgctgtatgatgacaacagc
atcatgaccttcaacctcagtcagctcccagggttgctagagctccttgtagaatatttc
cgacgatgcctgattgagatctttggcattttaaaggagtatgaggtgggtgacccagga
cagagaacgctactggatcctgggaggttcagcaaggtgtctagtccagctcccatggag
ggtggggaagaagaagaagaacttctaggtcctaaactagaagaggaagaagaagaggaa
gtagttgaaaatgatgaggagatagccttttcaggcaaggacaagccagcttcagagaat
agtgaggagaagctgatcagtaagtttgacaagcttccagtaaagatcgtacagaagaat
gatccatttgtggtggactgctcagataagcttgggcgtgtgcaggagtttgacagtggc
ctgctgcactggcggattggtgggggggacaccactgagcatatccagacccacttcgag
agcaagacagagctgctgccttcccggcctcacgcaccctgcccaccagcccctcggaag
catgtgacaacagcagagggtacaccagggacaacagaccaggaggggcccccacctgat
ggacctccagaaaaacggatcacagccactatggatgacatgttgtctactcggtctagc
accttgaccgaggatggagctaagagttcagaggccatcaaggagagcagcaagtttcca
tttggcattagcccagcacagagccaccggaacatcaagatcctagaggacgaaccccac
agtaaggatgagaccccactgtgtacccttctggactggcaggattctcttgccaagcgc
tgcgtctgtgtgtccaataccattcgaagcctgtcatttgtgccaggcaatgactttgag
atgtccaaacacccagggctgctgctcatcctgggcaagctgatcctgctgcaccacaag
cacccagaacggaagcaggcaccactaacttatgaaaaggaggaggaacaggaccaaggg
gtgagctgcaacaaagtggagtggtggtgggactgcttggagatgctccgggaaaacacc
ttggttacactcgccaacatctcggggcagttggacctatctccataccccgagagcatt
tgcctgcctgtcctggacggactcctacactgggcagtttgcccttcagctgaagcccag
gaccccttttccaccctgggccccaatgccgtcctttccccgcagagactggtcttggaa
accctcagcaaactcagcatccaggacaacaatgtggacctgattctggccacacccccc
ttcagccgcctggagaagttgtatagcactatggtgcgcttcctcagtgaccgaaagaac
ccggtgtgccgggagatggctgtggtactgctggccaacctggctcagggggacagcctg
gcagctcgtgccattgcagtgcagaagggcagtatcggcaacctcctgggcttcctagag
gacagccttgccgccacacagttccagcagagccaggccagcctcctccacatgcagaac
ccaccctttgagccaactagtgtggacatgatgcggcgggctgcccgcgcgctgcttgcc
ttggccaaggtggacgagaaccactcagagtttactctgtacgaatcacggctgttggac
atctcggtatcaccgttgatgaactcattggtttcacaagtcatttgtgatgtactgttt
ttgattggccagtcatga

DBGET integrated database retrieval system