KEGG   Homo sapiens (human): 829Help
Entry
829               CDS       T01001                                 

Gene name
CAPZA1, CAPPA1, CAPZ, CAZ1
Definition
(RefSeq) capping actin protein of muscle Z-line subunit alpha 1
  KO
K10364  capping protein (actin filament) muscle Z-line, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    829 (CAPZA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    829 (CAPZA1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    829 (CAPZA1)
   04147 Exosome [BR:hsa04147]
    829 (CAPZA1)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Others
   WASH complex
    829 (CAPZA1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Capping proteins
     829 (CAPZA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   829 (CAPZA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F-actin_cap_A CCP_MauG
Motif
Other DBs
NCBI-GeneID: 829
NCBI-ProteinID: NP_006126
OMIM: 601580
HGNC: 1488
Ensembl: ENSG00000116489
Vega: OTTHUMG00000011769
Pharos: P52907(Tbio)
UniProt: P52907 A0A024R0E5
LinkDB All DBs
Position
1p13.2
AA seq 286 aa AA seqDB search
MADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSW
RESCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSLTVSNEAQTAKEFIKIIENAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggccgacttcgatgatcgtgtgtcggatgaggagaaggtacgcatagctgctaaattc
atcactcatgcacccccaggggaatttaatgaagtattcaatgacgttcggctactactt
aataatgacaatctcctcagggaaggggcagcacatgcatttgcccagtataacatggat
cagttcacgcctgtgaagatagaaggatatgaagatcaggtcttaattacagagcacggt
gacctgggtaatagcagatttttagatccaagaaacaaaatttcctttaaatttgaccac
ttacggaaagaagcaagtgacccccagccagaagaagcagatggaggtctgaagtcttgg
agagaatcctgtgacagtgctttaagagcctatgtgaaagaccattattccaacggcttc
tgtactgtttatgctaaaactatcgatgggcaacagactattattgcatgtattgaaagc
caccagtttcagcctaaaaacttctggaatggtcgttggagatcagagtggaagttcacc
atcacaccacctacagcccaggtggttggcgtgcttaagattcaggttcactattatgaa
gatggcaatgttcagttggttagtcataaagatgtacaggattcactaactgtttcgaat
gaagcccaaactgccaaggagtttattaaaatcatagagaatgcagaaaatgagtatcag
acagcaattagtgaaaactatcaaacaatgtcagataccacattcaaggccttgcgccgg
cagcttccagttacccgcaccaaaatcgactggaacaagatactcagctacaagattggc
aaagaaatgcagaatgcttaa

KEGG   Homo sapiens (human): 830Help
Entry
830               CDS       T01001                                 

Gene name
CAPZA2, CAPPA2, CAPZ
Definition
(RefSeq) capping actin protein of muscle Z-line subunit alpha 2
  KO
K10364  capping protein (actin filament) muscle Z-line, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    830 (CAPZA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    830 (CAPZA2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    830 (CAPZA2)
   04147 Exosome [BR:hsa04147]
    830 (CAPZA2)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Others
   WASH complex
    830 (CAPZA2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Capping proteins
     830 (CAPZA2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   830 (CAPZA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F-actin_cap_A DUF5121 CCP_MauG
Motif
Other DBs
NCBI-GeneID: 830
NCBI-ProteinID: NP_006127
OMIM: 601571
HGNC: 1490
Ensembl: ENSG00000198898
Vega: OTTHUMG00000023185
Pharos: P47755(Tdark)
UniProt: P47755 A4D0V4
LinkDB All DBs
Position
7q31.2
AA seq 286 aa AA seqDB search
MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLD
QFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPCEVENAVESW
RTSVETALRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFT
ITPSTTQVVGILKIQVHYYEDGNVQLVSHKDIQDSLTVSNEVQTAKEFIKIVEAAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggcggatctggaggagcagttgtctgatgaagagaaggtgcgtatagcagcaaaattc
atcattcatgcccctcctggagaatttaatgaggttttcaatgatgttcggttactgctt
aataatgacaatcttctcagggaaggagcagcccatgcatttgcacagtataacttggac
cagtttactccagtaaaaattgaaggttatgaagatcaggtattgataacagaacatggc
gacttgggaaatggaaagtttttggatccaaagaacagaatctgttttaaatttgatcac
ttaaggaaggaggcaactgatccaagaccctgtgaagtagaaaatgcagttgaatcatgg
agaacttcagtagaaactgctctgagagcttacgtaaaagaacattacccgaatggagtc
tgcactgtgtatggcaaaaaaatagatggacagcaaaccattattgcatgcatagaaagc
catcagttccaagcaaaaaatttttggaatggtcgttggaggtcagaatggaagtttaca
atcactccttcaaccactcaagtggttggcatcttgaaaattcaggttcattattatgaa
gatggtaatgttcagctagtgagtcataaagatatacaagattccctaacagtgtctaat
gaagtgcaaacagcaaaagaatttataaagattgtagaagctgcagaaaatgaataccag
actgccatcagtgagaattatcagacaatgtcggacactactttcaaagccttacgtcga
cagttgccagttacacgcactaagattgattggaacaagatccttagctacaagattggc
aaagagatgcagaatgcataa

KEGG   Homo sapiens (human): 93661Help
Entry
93661             CDS       T01001                                 

Gene name
CAPZA3, CAPPA3, Gsg3, HEL-S-86
Definition
(RefSeq) capping actin protein of muscle Z-line subunit alpha 3
  KO
K10364  capping protein (actin filament) muscle Z-line, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    93661 (CAPZA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    93661 (CAPZA3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    93661 (CAPZA3)
   04147 Exosome [BR:hsa04147]
    93661 (CAPZA3)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Others
   WASH complex
    93661 (CAPZA3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Capping proteins
     93661 (CAPZA3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   93661 (CAPZA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F-actin_cap_A HemN_C
Motif
Other DBs
NCBI-GeneID: 93661
NCBI-ProteinID: NP_201585
OMIM: 608722
HGNC: 24205
Ensembl: ENSG00000177938
Vega: OTTHUMG00000169001
Pharos: Q96KX2(Tdark)
UniProt: Q96KX2 A0A140VKF6
LinkDB All DBs
Position
12p12.3
AA seq 299 aa AA seqDB search
MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYS
VPLCIDGNPVLLSHHNVMGDYRFFDHQSKLSFKYDLLQNQLKDIQSHGIIQNEAEYLRVV
LLCALKLYVNDHYPKGNCNMLRKTVKSKEYLIACIEDHNYETGECWNGLWKSKWIFQVNP
FLTQVTGRIFVQAHFFRCVNLHIEISKDLKESLEIVNQAQLALSFARLVEEQENKFQAAV
LEELQELSNEALRKILRRDLPVTRTLIDWHRILSDLNLVMYPKLGYVIYSRSVLCNWII
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacacttagcgtgctgagcaggaaggacaaggaaagagtaattcgcagactgttatta
caggcccctccaggggaatttgtaaatgcctttgatgatctctgtctgcttatccgtgat
gaaaaacttatgcaccaccaaggtgagtgtgcaggccaccaacactgccaaaaatattct
gtaccactctgcatcgatggaaatccagtactcttgtctcaccacaatgtaatgggcgac
taccgattttttgaccatcaaagcaaactttctttcaaatatgacctgcttcaaaatcag
ctgaaagacatccaaagtcatggtatcattcagaatgaggcagaatacctgagagttgtt
cttctgtgcgccttaaaactgtatgtgaatgaccactatccaaaaggaaattgcaacatg
ctgagaaaaactgtcaaaagtaaggagtacttgatagcttgcattgaagatcacaactat
gaaacaggagagtgctggaacggactttggaaatctaaatggattttccaagttaaccca
tttctaacccaagtaacgggaagaatatttgtgcaagctcacttcttcaggtgtgtcaac
cttcatattgaaatatccaaggacctgaaagaaagcttggaaatagttaaccaagctcaa
ctggctctaagttttgcaaggcttgtggaagagcaagagaacaaatttcaagctgcagtc
ttggaagaattacaggagttatccaatgaagccctgagaaaaattctacgaagggatctt
ccagtgacccgcactcttattgactggcacaggatactctctgacttgaatctggtgatg
tatcctaaattaggatatgtcatttattcaagaagtgtgttgtgcaactggataatataa

DBGET integrated database retrieval system