KEGG   Homo sapiens (human): 8322Help
Entry
8322              CDS       T01001                                 

Gene name
FZD4, CD344, EVR1, FEVR, FZD4S, Fz-4, Fz4, FzE4, GPCR, hFz4
Definition
(RefSeq) frizzled class receptor 4
  KO
K02354  frizzled 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Disease
H00589  Familial exudative vitreoretinopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8322 (FZD4)
   04390 Hippo signaling pathway
    8322 (FZD4)
   04150 mTOR signaling pathway
    8322 (FZD4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    8322 (FZD4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    8322 (FZD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8322 (FZD4)
   05205 Proteoglycans in cancer
    8322 (FZD4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    8322 (FZD4)
   05226 Gastric cancer
    8322 (FZD4)
   05217 Basal cell carcinoma
    8322 (FZD4)
   05224 Breast cancer
    8322 (FZD4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    8322 (FZD4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    8322 (FZD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    8322 (FZD4)
   04090 CD molecules [BR:hsa04090]
    8322 (FZD4)
G protein-coupled receptors [BR:hsa04030]
 Frizzled / Smoothened family
  8322 (FZD4)
CD molecules [BR:hsa04090]
 Proteins
  8322 (FZD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz DUF5083 Chol_subst-bind
Motif
Other DBs
NCBI-GeneID: 8322
NCBI-ProteinID: NP_036325
OMIM: 604579
HGNC: 4042
Ensembl: ENSG00000174804
Vega: OTTHUMG00000167231
Pharos: Q9ULV1(Tbio)
UniProt: Q9ULV1
LinkDB All DBs
Structure
PDB: 

Position
11q14.2
AA seq 537 aa AA seqDB search
MAWRGAGPSVPGAPGGVGLSLGLLLQLLLLLGPARGFGDEEERRCDPIRISMCQNLGYNV
TKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGM
CLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
CHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLT
FLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNT
GCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTI
VILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL
QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLK
IFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcggggcgcagggccgagcgtcccgggggcgcccgggggcgtcggtctcagt
ctggggttgctcctgcagttgctgctgctcctggggccggcgcggggcttcggggacgag
gaagagcggcgctgcgaccccatccgcatctccatgtgccagaacctcggctacaacgtg
accaagatgcccaacctggttgggcacgagctgcagacggacgccgagctgcagctgaca
actttcacaccgctcatccagtacggctgctccagccagctgcagttcttcctttgttct
gtttatgtgccaatgtgcacagagaagatcaacatccccattggcccatgcggcggcatg
tgtctttcagtcaagagacgctgtgaacccgtcctgaaggaatttggatttgcctggcca
gagagtctgaactgcagcaaattcccaccacagaacgaccacaaccacatgtgcatggaa
gggccaggtgatgaagaggtgcccttacctcacaaaacccccatccagcctggggaagag
tgtcactctgtgggaaccaattctgatcagtacatctgggtgaaaaggagcctgaactgt
gtgctcaagtgtggctatgatgctggcttatacagccgctcagccaaggagttcactgat
atctggatggctgtgtgggccagcctgtgtttcatctccactgccttcacagtactgacc
ttcctgatcgattcttctaggttttcctaccctgagcgccccatcatatttctcagtatg
tgctataatatttatagcattgcttatattgtcaggctgactgtaggccgggaaaggata
tcctgtgattttgaagaggcagcagaacctgttctcatccaagaaggacttaagaacaca
ggatgtgcaataattttcttgctgatgtacttttttggaatggccagctccatttggtgg
gttattctgacactcacttggtttttggcagcaggactcaaatggggtcatgaagccatt
gaaatgcacagctcttatttccacattgcagcctgggccatccccgcagtgaaaaccatt
gtcatcttgattatgagactggtggatgcagatgaactgactggcttgtgctatgttgga
aaccaaaatctcgatgccctcaccgggttcgtggtggctcccctctttacttatttggtc
attggaactttgttcattgctgcaggtttggtggccttgttcaaaattcggtcaaatctt
caaaaggatgggacaaagacagacaagttagaaagactgatggtcaagattggggtgttc
tcagtactgtacacagttcctgcaacgtgtgtgattgcctgttatttttatgaaatctcc
aactgggcactttttcggtattctgcagatgattccaacatggctgttgaaatgttgaaa
atttttatgtctttgttggtgggcatcacttcaggcatgtggatttggtctgccaaaact
cttcacacgtggcagaagtgttccaacagattggtgaattctggaaaggtaaagagagag
aagagaggaaatggttgggtgaagcctggaaaaggcagtgagactgtggtataa

DBGET integrated database retrieval system