KEGG   Homo sapiens (human): 8335Help
Entry
8335              CDS       T01001                                 

Gene name
H2AC4, H2A/m, H2AFM, HIST1H2AB
Definition
(RefSeq) H2A clustered histone 4
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    8335 (H2AC4)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8335 (H2AC4)
  09165 Substance dependence
   05034 Alcoholism
    8335 (H2AC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8335 (H2AC4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8335 (H2AC4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8335 (H2AC4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8335 (H2AC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Motif
Other DBs
NCBI-GeneID: 8335
NCBI-ProteinID: NP_003504
OMIM: 602795
HGNC: 4734
Ensembl: ENSG00000278463
Vega: OTTHUMG00000014420
Pharos: P04908(Tdark)
UniProt: P04908 Q08AJ9
LinkDB All DBs
Structure
PDB: 

Position
6p22.2
AA seq 130 aa AA seqDB search
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtcgcggcaaacaaggcggtaaagctcgcgccaaggctaagactcggtcttct
cgtgcaggtttgcagtttcctgtgggccgagtgcaccgcctgctccgcaaaggcaactac
tccgagcgcgtcggggctggcgcgccggtgtatctcgcggcggtgcttgagtacctgacc
gccgagatcctggagctggcgggcaatgcggcccgcgacaacaagaagacccgcatcatc
ccgcgccacctgcaattggccatccgcaatgacgaggagcttaataaactcttggggcgt
gtgaccatcgcgcagggtggcgttttgcctaatattcaggcggtgctgctgcctaagaaa
actgagagccatcataaggccaagggaaagtga

DBGET integrated database retrieval system