KEGG   Homo sapiens (human): 834Help
Entry
834               CDS       T01001                                 

Gene name
CASP1, ICE, IL1BC, P45
Definition
(RefSeq) caspase 1
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05135  Yersinia infection
hsa05164  Influenza A
Network
nt06139  NLR signaling (viruses and bacteria)
nt06170  Influenza A virus (IAV)
  Element
N00742  NLRP3 Inflammasome signaling pathway
N00743  IAV NS1 to NLRP3 inflammasome signaling pathway
N00863  Yersinia YopM to NLRP3 Inflammasome signaling pathway
N00864  Yersinia YopK to NLRP3 Inflammasome signaling pathway
N00865  Yersinia YopK to NLRC4 Inflammasome signaling pathway
N00866  Yersinia YopM to Pyrin Inflammasome signaling pathway
N00867  NLRC4 Inflammasome signaling pathway
N00868  Pyrin Inflammasome signaling pathway
N00933  Escherichia NleA to NLRP3 inflammasome signaling pathway
N00934  Non-canonical inflammasome signaling pathway
N00935  Escherichia NleF to non-canonical inflammasome signaling pathway
N00948  Shigella IpaH7.8 to NLRP3 Inflammasome signaling pathway
N00949  Shigella IpaB to NLRC4 Inflammasome signaling pathway
Drug target
Belnacasan: D10416
Emricasan: D10004
Nivocasan: D09938
Pralnacasan: D08978
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    834 (CASP1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    834 (CASP1)
   04623 Cytosolic DNA-sensing pathway
    834 (CASP1)
   04625 C-type lectin receptor signaling pathway
    834 (CASP1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    834 (CASP1)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    834 (CASP1)
   05132 Salmonella infection
    834 (CASP1)
   05131 Shigellosis
    834 (CASP1)
   05135 Yersinia infection
    834 (CASP1)
   05133 Pertussis
    834 (CASP1)
   05134 Legionellosis
    834 (CASP1)
  09172 Infectious disease: viral
   05164 Influenza A
    834 (CASP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    834 (CASP1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    834 (CASP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     834 (CASP1)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C14: caspase family
   834 (CASP1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    834 (CASP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD
Motif
Other DBs
NCBI-GeneID: 834
NCBI-ProteinID: NP_001244047
OMIM: 147678
HGNC: 1499
Ensembl: ENSG00000137752
Vega: OTTHUMG00000048072
Pharos: P29466(Tchem)
UniProt: P29466 A8K249
LinkDB All DBs
Structure
PDB: 

Position
11q22.3
AA seq 404 aa AA seqDB search
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDS
VIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDN
PAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRT
GAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIR
EGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG
VSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEY
ACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaaggtcctgaaggagaagagaaagctgtttatccgttccatgggtgaaggt
acaataaatggcttactggatgaattattacagacaagggtgctgaacaaggaagagatg
gagaaagtaaaacgtgaaaatgctacagttatggataagacccgagctttgattgactcc
gttattccgaaaggggcacaggcatgccaaatttgcatcacatacatttgtgaagaagac
agttacctggcagggacgctgggactctcagcagatcaaacatctggaaattaccttaat
atgcaagactctcaaggagtactttcttcctttccagctcctcaggcagtgcaggacaac
ccagctatgcccacatcctcaggctcagaagggaatgtcaagctttgctccctagaagaa
gctcaaaggatatggaaacaaaagtcggcagagatttatccaataatggacaagtcaagc
cgcacacgtcttgctctcattatctgcaatgaagaatttgacagtattcctagaagaact
ggagctgaggttgacatcacaggcatgacaatgctgctacaaaatctggggtacagcgta
gatgtgaaaaaaaatctcactgcttcggacatgactacagagctggaggcatttgcacac
cgcccagagcacaagacctctgacagcacgttcctggtgttcatgtctcatggtattcgg
gaaggcatttgtgggaagaaacactctgagcaagtcccagatatactacaactcaatgca
atctttaacatgttgaataccaagaactgcccaagtttgaaggacaaaccgaaggtgatc
atcatccaggcctgccgtggtgacagccctggtgtggtgtggtttaaagattcagtagga
gtttctggaaacctatctttaccaactacagaagagtttgaggatgatgctattaagaaa
gcccacatagagaaggattttatcgctttctgctcttccacaccagataatgtttcttgg
agacatcccacaatgggctctgtttttattggaagactcattgaacatatgcaagaatat
gcctgttcctgtgatgtggaggaaattttccgcaaggttcgattttcatttgagcagcca
gatggtagagcgcagatgcccaccactgaaagagtgactttgacaagatgtttctacctc
ttcccaggacattaa

DBGET integrated database retrieval system