KEGG   Homo sapiens (human): 8349Help
Entry
8349              CDS       T01001                                 

Gene name
HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ
Definition
(RefSeq) histone cluster 2 H2B family member e
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    8349 (HIST2H2BE)
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    8349 (HIST2H2BE)
  09165 Substance dependence
   05034 Alcoholism
    8349 (HIST2H2BE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8349 (HIST2H2BE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8349 (HIST2H2BE)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    8349 (HIST2H2BE)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8349 (HIST2H2BE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 8349
NCBI-ProteinID: NP_003519
OMIM: 601831
HGNC: 4760
Ensembl: ENSG00000184678
Vega: OTTHUMG00000012095
Pharos: Q16778(Tbio)
UniProt: Q16778
LinkDB All DBs
Position
1q21.2
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccggcaaaatccgctccggcccctaaaaagggctccaagaaagccgtcacc
aaagcccagaagaaagacggcaagaagcgcaagcgcagccgcaaagagagctactccatc
tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggagaggcttcccgc
ctggcgcactacaacaagcgctccaccatcacatcccgcgagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system