KEGG   Homo sapiens (human): 83539
Entry
83539             CDS       T01001                                 

Gene name
CHST9, GALNAC4ST-2, GalNAc4ST2
Definition
(RefSeq) carbohydrate sulfotransferase 9
  KO
K09673  carbohydrate 4-sulfotransferase 9 [EC:2.8.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00513  Various types of N-glycan biosynthesis
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    83539 (CHST9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    83539 (CHST9)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     83539 (CHST9)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   83539 (CHST9)
SSDB
Motif
Pfam: Sulfotransfer_2 SieB
Other DBs
NCBI-GeneID: 83539
NCBI-ProteinID: NP_113610
OMIM: 610191
HGNC: 19898
Ensembl: ENSG00000154080
Vega: OTTHUMG00000179469
Pharos: Q7L1S5(Tbio)
UniProt: Q7L1S5 A0A024RC28
LinkDB
Position
18q11.2
AA seq 443 aa
MQPSEMVMNPKQVFLSVLIFGVAGLLLFMYLQVWIEEQHTGRVEKRREQKVTSGWGPVKY
LRPVPRIMSTEKIQEHITNQNPKFHMPEDVREKKENLLLNSERSTRLLTKTSHSQGGDQA
LSKSTGSPTEKLIEKRQGAKTVFNKFSNMNWPVDIHPLNKSLVKDNKWKKTEETQEKRRS
FLQEFCKKYGGVSHHQSHLFHTVSRIYVEDKHKILYCEVPKAGCSNWKRILMVLNGLASS
AYNISHNAVHYGKHLKKLDSFDLKGIYTRLNTYTKAVFVRDPMERLVSAFRDKFEHPNSY
YHPVFGKAIIKKYRPNACEEALINGSGVKFKEFIHYLLDSHRPVGMDIHWEKVSKLCYPC
LINYDFVGKFETLEEDANYFLQMIGAPKELKFPNFKDRHSSDERTNAQVVRQYLKDLTRT
ERQLIYDFYYLDYLMFNYTTPFL
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgcagccatctgaaatggtcatgaaccccaaacaagtcttcctctctgtgctgatattt
ggagtagctgggctactcctcttcatgtatttgcaagtctggattgaagaacaacataca
gggagagtggagaagagaagagaacaaaaagtaacttcaggatggggaccagtgaagtac
ttgcggcctgtacccagaatcatgagtacagaaaaaatccaggaacatatcaccaaccag
aaccccaagtttcacatgcctgaggatgtacgagaaaaaaaggaaaatcttctactcaat
tctgagagatctactaggctcttaacaaagaccagtcattcacaaggaggggatcaagct
ttaagtaagtccacagggtcaccaacagagaagttgattgaaaaacgtcaaggagctaag
actgtttttaacaagttcagcaacatgaattggccagtggacattcaccctttaaacaaa
agtttagtcaaagataataaatggaagaaaactgaggagacccaagagaaacgaaggtct
ttccttcaggagttttgcaagaaatacggtggggtgagtcatcatcagtcacatcttttt
catacagtatccagaatctatgtagaagataaacacaaaatcttatattgtgaggtacct
aaggctggctgttccaattggaaaagaattctgatggtactaaatggattggcttcctct
gcatacaacatctcccacaatgctgtccactacgggaagcatttgaagaagctagatagc
tttgacctaaaagggatatatacccgcttaaatacttacaccaaagctgtgtttgttcgt
gatcccatggaaagattagtatcagcctttagggacaaatttgaacaccccaatagttat
taccatccagtattcggaaaggcaattatcaagaaatatcgaccaaatgcctgtgaagaa
gcattaattaatggatctggagtcaagttcaaagagtttatccactacttgctggattcc
caccgtccagtaggaatggacattcactgggaaaaggtcagcaaactctgctatccgtgt
ttgatcaactatgattttgtagggaaatttgagactttggaagaagatgccaattacttt
ttacagatgatcggtgctccaaaggagctgaaatttcccaactttaaggataggcactct
tccgatgaaagaaccaatgctcaagtcgtgagacagtatttaaaggatctgactagaact
gagagacaattaatctatgacttttattacttggactatttaatgtttaattatacaact
ccatttttgtag

DBGET integrated database retrieval system