KEGG   Homo sapiens (human): 83547Help
Entry
83547             CDS       T01001                                 

Gene name
RILP, PP10141
Definition
(RefSeq) Rab interacting lysosomal protein
  KO
K13883  Rab-interacting lysosomal protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    83547 (RILP)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    83547 (RILP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    83547 (RILP)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    83547 (RILP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RILP Jnk-SapK_ap_N Macoilin HOOK V_ATPase_I Spc7
Motif
Other DBs
NCBI-GeneID: 83547
NCBI-ProteinID: NP_113618
OMIM: 607848
HGNC: 30266
Ensembl: ENSG00000167705
Vega: OTTHUMG00000090554
Pharos: Q96NA2(Tbio)
UniProt: Q96NA2
LinkDB All DBs
Structure
PDB: 

Position
17p13.3
AA seq 401 aa AA seqDB search
MEPRRAAPGVPGWGSREAAGSASAAELVYHLAGALGTELQDLARRFGPEAAAGLVPLVVR
ALELLEQAAVGPAPDSLQVSAQPAEQELRRLREENERLRRELRAGPQEERALLRQLKEVT
DRQRDELRAHNRDLRQRGQETEALQEQLQRLLLVNAELRHKLAAMQTQLRAAQDRERERQ
QPGEAATPQAKERARGQAGRPGHQHGQEPEWATAGAGAPGNPEDPAEAAQQLGRPSEAGQ
CRFSREEFEQILQERNELKAKVFLLKEELAYFQRELLTDHRVPGLLLEAMKVAVRKQRKK
IKAKMLGTPEEAESSEDEAGPWILLSDDKGDHPPPPESKIQSFFGLWYRGKAESSEDETS
SPAPSKLGGEEEAQPQSPAPDPPCSALHEHLCLGASAAPEA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggagcccaggagggcggcgcccggggtgcctggctgggggtctcgggaggccgcgggg
tcggcatcggccgcggagcttgtgtaccatctagccggggccctgggcactgagctgcag
gatctggcgcgccgtttcgggccggaggcggcggccgggctggtgccgctagtggtgcgg
gcgctggagctcttggaacaggctgccgtggggcccgccccggactcgctgcaggtgtcg
gcgcagccggcggagcaggagctgcggcggctgcgggaggagaacgagcgcctccgcagg
gagctgcgcgcggggccacaggaggagcgcgcgctgctgcggcagctcaaggaggtcacg
gaccgacagcgggacgaactccgggcgcacaaccgcgacctgcggcagcgcggccaggag
accgaggcgttgcaggagcagctgcagcgcctcctgctggtgaacgctgagctgcggcac
aagctggcggccatgcagacccagctgcgcgccgcgcaggaccgcgagagggagcgccag
cagcctggcgaagccgcgactccgcaggctaaagagcgagcgcgggggcaggccgggcgg
cccgggcaccagcacggacaggagcccgaatgggcgaccgccggcgcaggcgccccaggg
aaccctgaggacccggcggaggccgcgcagcagctcgggcgcccctcggaggcagggcag
tgccgcttcagtcgggaggagtttgagcagatccttcaggagcggaatgaactcaaagcc
aaagtgttcctgctcaaggaggaactggcctacttccagcgggagctgctcacagaccac
cgggtccccggccttctgctcgaggccatgaaggtggctgtccggaagcagcggaagaag
atcaaggccaagatgttagggacaccagaggaagcagagagcagtgaggatgaggctggc
ccatggatcctgctctccgatgacaagggagaccatcccccacccccggagtccaaaata
cagagtttctttggcctatggtatcggggtaaagctgaatcctctgaggatgagaccagc
agccctgcacccagcaagctagggggagaagaggaggcccaaccacagtctccagctcct
gatccgccctgttctgccctccacgaacacctttgtctgggggcctcagccgccccagag
gcctga

DBGET integrated database retrieval system