KEGG   Homo sapiens (human): 83594
Entry
83594             CDS       T01001                                 

Gene name
NUDT12
Definition
(RefSeq) nudix hydrolase 12
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00760  Nicotinate and nicotinamide metabolism
hsa01100  Metabolic pathways
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    83594 (NUDT12)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    83594 (NUDT12)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     83594 (NUDT12)
SSDB
Motif
Pfam: NUDIX Ank_2 Ank_5 Ank_4 Ank Ank_3 zf-NADH-PPase NUDIX-like DNA_ligase_ZBD
Other DBs
NCBI-GeneID: 83594
NCBI-ProteinID: NP_113626
OMIM: 609232
HGNC: 18826
Ensembl: ENSG00000112874
Vega: OTTHUMG00000128739
Pharos: Q9BQG2(Tbio)
UniProt: Q9BQG2
LinkDB
Position
5q21.2
AA seq 462 aa
MSSVKRSLKQEIVTQFHCSAAEGDIAKLTGILSHSPSLLNETSENGWTALMYAARNGHPE
IVQFLLEKGCDRSIVNKSRQTALDIAVFWGYKHIANLLATAKGGKKPWFLTNEVEECENY
FSKTLLDRKSEKRNNSDWLLAKESHPATVFILFSDLNPLVTLGGNKESFQQPEVRLCQLN
YTDIKDYLAQPEKITLIFLGVELEIKDKLLNYAGEVPREEEDGLVAWFALGIDPIAAEEF
KQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSRYKFCPTCGNATKIEEGGYKR
LCLKEDCPSLNGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFIEPG
ETIEDAVRREVEEESGVKVGHVQYVACQPWPMPSSLMIGCLALAVSTEIKVDKNEIEDAR
WFTREQVLDVLTKGKQQAFFVPPSRAIAHQLIKHWIRINPNL
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgtcttctgtaaaaagaagtctgaagcaagaaatagttactcagtttcactgttcagct
gctgaaggagatattgccaagttaacaggaatactcagtcattctccatctcttctcaat
gaaacttctgaaaatggctggactgctttaatgtatgcggcaaggaatgggcacccagag
atagtccaatttctgcttgagaaagggtgtgacagatcaattgtcaataaatcaaggcag
actgcactggacattgctgtattttggggttataagcatatagctaatttactagctact
gctaaaggtgggaagaagccttggttcctaacgaatgaagtggaagaatgtgaaaattat
tttagcaaaacactactggaccggaaaagtgaaaagagaaataattctgactggctgcta
gctaaagaaagccatccagccacagtttttattcttttctcagatttaaatcccttggtt
actctaggtggcaataaagaaagtttccaacagccagaagttaggctttgtcagctgaac
tacacagatataaaggattatttggcccagcctgagaagatcaccttgatttttcttgga
gtagaacttgaaataaaagacaaactacttaattatgctggtgaagtcccgagagaggag
gaagatggattggttgcctggtttgctctaggtatagatcctattgctgctgaagaattc
aagcaaagacatgaaaattgttactttcttcatcctcctatgccagcccttctgcaattg
aaagaaaaagaagctggggttgtagctcaagcaagatctgttcttgcctggcacagtcga
tacaagttttgcccaacctgtggaaatgcaactaaaattgaagaaggtggctataagaga
ttatgtttaaaagaagactgtcctagtctcaatggcgtccataatacctcatacccaaga
gttgatccagtagtaatcatgcaagttattcatccagatgggaccaaatgccttttaggc
aggcagaaaagatttcccccaggcatgtttacttgccttgctggatttattgagcctgga
gagacaatagaagatgctgttaggagagaagtagaagaggaaagtggagtcaaagttggc
catgttcagtatgttgcttgtcaaccatggccaatgccttcctccttaatgattggttgc
ttagctctagcagtgtctacagaaattaaagttgacaagaatgaaatagaggatgcccgc
tggttcactagagaacaggtcctggatgttctgaccaaagggaagcagcaggcattcttt
gtgccaccaagccgagctattgcacatcaattaatcaaacactggattagaataaatcct
aatctctaa

DBGET integrated database retrieval system