KEGG   Homo sapiens (human): 836Help
Entry
836               CDS       T01001                                 

Gene name
CASP3, CPP32, CPP32B, SCA-1
Definition
(RefSeq) caspase 3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04010  MAPK signaling pathway
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04650  Natural killer cell mediated cytotoxicity
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04726  Serotonergic synapse
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05016  Huntington disease
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05210  Colorectal cancer
hsa05222  Small cell lung cancer
hsa05416  Viral myocarditis
Network
nt06131  Apoptosis (virus)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
nt06231  Apoptosis
nt06260  Colorectal cancer
nt06267  Small cell lung cancer
  Element
N00098  Intrinsic apoptotic pathway
N00100  BCL2-overexpression to intrinsic apoptotic pathway
N00101  DCC-apoptotic pathway
N00102  Loss of DCC to DCC-apoptotic pathway
N00145  Extrinsic apoptotic pathway
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00164  KSHV vBCL2 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00165  KSHV vIAP to crosstalk between extrinsic and intrinsic apoptotic pathways
N00262  EBV EBNA3C to intrinsic apoptotic pathway
N00350  HPV E6 to extrinsic apoptotic pathway
N00351  HPV E6 to extrinsic apoptotic pathway
N00352  HPV E6 to extrinsic apoptotic pathway
N00425  HCMV UL36 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00426  HCMV UL37x1 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00449  HIV Tat/Nef to crosstalk between extrinsic and intrinsic apoptotic pathways
N00450  HIV Tat to intrinsic apoptotic pathway
N00451  HIV Tat to intrinsic apoptotic pathway
N00452  HIV Nef to intrinsic apoptotic pathway
N00453  HIV Vpr to intrinsic apoptotic pathway
N00454  HIV Vpr to intrinsic apoptotic pathway
N00474  EBV BHRF1 to intrinsic apoptotic pathway
N00475  EBV BHRF1 to intrinsic apoptotic pathway
N00476  EBV BHRF1 to intrinsic apoptotic pathway
N00477  EBV BHRF1 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00478  EBV BARF1 to intrinsic apoptotic pathway
N00524  HCV NS5A to extrinsic apoptotic pathway
N00526  HCV NS3 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00527  HCV Core to crosstalk between extrinsic and intrinsic apoptotic pathways
N00528  HCV core to extrinsic apoptotic pathway
N00533  HBV HBx to Crosstalk between extrinsic and intrinsic apoptotic pathways
N00534  HBV HBx to Crosstalk between extrinsic and intrinsic apoptotic pathways
N00579  HSV ICP6 to extrinsic apoptotic pathway
N00580  HSV ICP0 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00585  HSV US3 to intrinsic apoptotic pathway
N00745  IAV PB1-F2 to intrinsic apoptotic pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    836 (CASP3)
   04668 TNF signaling pathway
    836 (CASP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    836 (CASP3)
   04215 Apoptosis - multiple species
    836 (CASP3)
   04115 p53 signaling pathway
    836 (CASP3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    836 (CASP3)
   04657 IL-17 signaling pathway
    836 (CASP3)
  09156 Nervous system
   04726 Serotonergic synapse
    836 (CASP3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    836 (CASP3)
   05206 MicroRNAs in cancer
    836 (CASP3)
   05205 Proteoglycans in cancer
    836 (CASP3)
   05203 Viral carcinogenesis
    836 (CASP3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    836 (CASP3)
   05222 Small cell lung cancer
    836 (CASP3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    836 (CASP3)
   05012 Parkinson disease
    836 (CASP3)
   05014 Amyotrophic lateral sclerosis (ALS)
    836 (CASP3)
   05016 Huntington disease
    836 (CASP3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    836 (CASP3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    836 (CASP3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    836 (CASP3)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    836 (CASP3)
   05133 Pertussis
    836 (CASP3)
   05134 Legionellosis
    836 (CASP3)
   05152 Tuberculosis
    836 (CASP3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    836 (CASP3)
   05162 Measles
    836 (CASP3)
   05164 Influenza A
    836 (CASP3)
   05161 Hepatitis B
    836 (CASP3)
   05160 Hepatitis C
    836 (CASP3)
   05168 Herpes simplex virus 1 infection
    836 (CASP3)
   05163 Human cytomegalovirus infection
    836 (CASP3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    836 (CASP3)
   05169 Epstein-Barr virus infection
    836 (CASP3)
   05165 Human papillomavirus infection
    836 (CASP3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    836 (CASP3)
   05145 Toxoplasmosis
    836 (CASP3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    836 (CASP3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     836 (CASP3)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C14: caspase family
   836 (CASP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14
Motif
Other DBs
NCBI-GeneID: 836
NCBI-ProteinID: NP_004337
OMIM: 600636
HGNC: 1504
Ensembl: ENSG00000164305
Vega: OTTHUMG00000133681
Pharos: P42574(Tchem)
UniProt: P42574
LinkDB All DBs
Structure
PDB: 

Position
4q35.1
AA seq 277 aa AA seqDB search
MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTG
MTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLS
HGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDD
DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN
RKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggagaacactgaaaactcagtggattcaaaatccattaaaaatttggaaccaaagatc
atacatggaagcgaatcaatggactctggaatatccctggacaacagttataaaatggat
tatcctgagatgggtttatgtataataattaataataagaattttcataaaagcactgga
atgacatctcggtctggtacagatgtcgatgcagcaaacctcagggaaacattcagaaac
ttgaaatatgaagtcaggaataaaaatgatcttacacgtgaagaaattgtggaattgatg
cgtgatgtttctaaagaagatcacagcaaaaggagcagttttgtttgtgtgcttctgagc
catggtgaagaaggaataatttttggaacaaatggacctgttgacctgaaaaaaataaca
aactttttcagaggggatcgttgtagaagtctaactggaaaacccaaacttttcattatt
caggcctgccgtggtacagaactggactgtggcattgagacagacagtggtgttgatgat
gacatggcgtgtcataaaataccagtggaggccgacttcttgtatgcatactccacagca
cctggttattattcttggcgaaattcaaaggatggctcctggttcatccagtcgctttgt
gccatgctgaaacagtatgccgacaagcttgaatttatgcacattcttacccgggttaac
cgaaaggtggcaacagaatttgagtccttttcctttgacgctacttttcatgcaaagaaa
cagattccatgtattgtttccatgctcacaaaagaactctatttttatcactaa

KEGG   Homo sapiens (human): 841Help
Entry
841               CDS       T01001                                 

Gene name
CASP8, ALPS2B, CAP4, Casp-8, FLICE, MACH, MCH5
Definition
(RefSeq) caspase 8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05016  Huntington disease
hsa05134  Legionellosis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05416  Viral myocarditis
Network
nt06131  Apoptosis (virus)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06231  Apoptosis
  Element
N00145  Extrinsic apoptotic pathway
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00350  HPV E6 to extrinsic apoptotic pathway
N00351  HPV E6 to extrinsic apoptotic pathway
N00352  HPV E6 to extrinsic apoptotic pathway
N00425  HCMV UL36 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00449  HIV Tat/Nef to crosstalk between extrinsic and intrinsic apoptotic pathways
N00524  HCV NS5A to extrinsic apoptotic pathway
N00526  HCV NS3 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00527  HCV Core to crosstalk between extrinsic and intrinsic apoptotic pathways
N00528  HCV core to extrinsic apoptotic pathway
N00579  HSV ICP6 to extrinsic apoptotic pathway
Disease
H00108  Autoimmune lymphoproliferative syndromes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    841 (CASP8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    841 (CASP8)
   04215 Apoptosis - multiple species
    841 (CASP8)
   04217 Necroptosis
    841 (CASP8)
   04115 p53 signaling pathway
    841 (CASP8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    841 (CASP8)
   04621 NOD-like receptor signaling pathway
    841 (CASP8)
   04622 RIG-I-like receptor signaling pathway
    841 (CASP8)
   04625 C-type lectin receptor signaling pathway
    841 (CASP8)
   04657 IL-17 signaling pathway
    841 (CASP8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    841 (CASP8)
   05203 Viral carcinogenesis
    841 (CASP8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    841 (CASP8)
   05016 Huntington disease
    841 (CASP8)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    841 (CASP8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    841 (CASP8)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    841 (CASP8)
   05152 Tuberculosis
    841 (CASP8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    841 (CASP8)
   05162 Measles
    841 (CASP8)
   05164 Influenza A
    841 (CASP8)
   05161 Hepatitis B
    841 (CASP8)
   05160 Hepatitis C
    841 (CASP8)
   05168 Herpes simplex virus 1 infection
    841 (CASP8)
   05163 Human cytomegalovirus infection
    841 (CASP8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    841 (CASP8)
   05169 Epstein-Barr virus infection
    841 (CASP8)
   05165 Human papillomavirus infection
    841 (CASP8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    841 (CASP8)
   05142 Chagas disease (American trypanosomiasis)
    841 (CASP8)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    841 (CASP8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     841 (CASP8)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C14: caspase family
   841 (CASP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 DED PYRIN
Motif
Other DBs
NCBI-GeneID: 841
NCBI-ProteinID: NP_203519
OMIM: 601763
HGNC: 1509
Ensembl: ENSG00000064012
Vega: OTTHUMG00000132821
Pharos: Q14790(Tchem)
UniProt: Q14790
LinkDB All DBs
Structure
PDB: 

Position
2q33.1
AA seq 479 aa AA seqDB search
MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLS
FLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSF
KFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEE
FSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIIN
NHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQ
LMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQAC
QGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTW
YIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggacttcagcagaaatctttatgatattggggaacaactggacagtgaagatctggcc
tccctcaagttcctgagcctggactacattccgcaaaggaagcaagaacccatcaaggat
gccttgatgttattccagagactccaggaaaagagaatgttggaggaaagcaatctgtcc
ttcctgaaggagctgctcttccgaattaatagactggatttgctgattacctacctaaac
actagaaaggaggagatggaaagggaacttcagacaccaggcagggctcaaatttctgcc
tacagggtcatgctctatcagatttcagaagaagtgagcagatcagaattgaggtctttt
aagtttcttttgcaagaggaaatctccaaatgcaaactggatgatgacatgaacctgctg
gatattttcatagagatggagaagagggtcatcctgggagaaggaaagttggacatcctg
aaaagagtctgtgcccaaatcaacaagagcctgctgaagataatcaacgactatgaagaa
ttcagcaaagagagaagcagcagccttgaaggaagtcctgatgaattttcaaatggggag
gagttgtgtggggtaatgacaatctcggactctccaagagaacaggatagtgaatcacag
actttggacaaagtttaccaaatgaaaagcaaacctcggggatactgtctgatcatcaac
aatcacaattttgcaaaagcacgggagaaagtgcccaaacttcacagcattagggacagg
aatggaacacacttggatgcaggggctttgaccacgacctttgaagagcttcattttgag
atcaagccccacgatgactgcacagtagagcaaatctatgagattttgaaaatctaccaa
ctcatggaccacagtaacatggactgcttcatctgctgtatcctctcccatggagacaag
ggcatcatctatggcactgatggacaggaggcccccatctatgagctgacatctcagttc
actggtttgaagtgcccttcccttgctggaaaacccaaagtgttttttattcaggcttgt
cagggggataactaccagaaaggtatacctgttgagactgattcagaggagcaaccctat
ttagaaatggatttatcatcacctcaaacgagatatatcccggatgaggctgactttctg
ctggggatggccactgtgaataactgtgtttcctaccgaaaccctgcagagggaacctgg
tacatccagtcactttgccagagcctgagagagcgatgtcctcgaggcgatgatattctc
accatcctgactgaagtgaactatgaagtaagcaacaaggatgacaagaaaaacatgggg
aaacagatgcctcagcctactttcacactaagaaaaaaacttgtcttcccttctgattga

DBGET integrated database retrieval system