KEGG   Homo sapiens (human): 83706Help
Entry
83706             CDS       T01001                                 

Gene name
FERMT3, KIND3, MIG-2, MIG2B, UNC112C, URP2, URP2SF
Definition
(RefSeq) fermitin family member 3
  KO
K17084  kindlin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04611  Platelet activation
Disease
H00099  Leukocyte adhesion deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    83706 (FERMT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    83706 (FERMT3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   83706 (FERMT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FERM_M Kindlin_2_N PH FERM_N PH_17
Motif
Other DBs
NCBI-GeneID: 83706
NCBI-ProteinID: NP_848537
OMIM: 607901
HGNC: 23151
Ensembl: ENSG00000149781
Vega: OTTHUMG00000167790
Pharos: Q86UX7(Tbio)
UniProt: Q86UX7
LinkDB All DBs
Structure
PDB: 

Position
11q13.1
AA seq 667 aa AA seqDB search
MAGMKTASGDYIDSSWELRVFVGEEDPEAESVTLRVTGESHIGGVLLKIVEQINRKQDWS
DHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRALRLRASFSQPL
FQAVAAICRLLSIRHPEELSLLRAPEKKEKKKKEKEPEEELYDLSKVVLAGGVAPALFRG
MPAHFSDSAQTEACYHMLSRPQPPPDPLLLQRLPRPSSLSDKTQLHSRWLDSSRCLMQQG
IKAGDALWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLLLEEIDCTEEEMMVFAALQYH
INKLSQSGEVGEPAGTDPGLDDLDVALSNLEVKLEGSAPTDVLDSLTTIPELKDHLRIFR
IPRRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKF
CIKLLVPSPEGMSEIYLRCQDEQQYARWMAGCRLASKGRTMADSSYTSEVQAILAFLSLQ
RTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLAEAQ
LRFIQAWQSLPDFGISYVMVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQW
NVNWDIRQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQL
TGGHEAF
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggcggggatgaagacagcctccggggactacatcgactcgtcatgggagctgcgggtg
tttgtgggagaggaggacccagaggccgagtcggtcaccctgcgggtcactggggagtcg
cacatcggcggggtgctcctgaagattgtggagcagatcaatcgcaagcaggactggtca
gaccatgctatttggtgggaacagaagaggcagtggctgctgcagacccactggacactg
gacaagtacgggatcctggccgacgcacgcctcttctttgggccccagcaccggcccgtc
atccttcggttgcccaaccgccgcgcactgcgcctccgtgccagcttctcccagcccctc
ttccaggctgtggctgccatctgccgcctcctcagcatccggcaccccgaggagctgtcc
ctgctccgggctcctgagaagaaggagaagaagaagaaagagaaggagccagaggaagag
ctctatgacttgagcaaggttgtcttggctgggggcgtggcacctgcactgttccggggg
atgccagctcacttctcggacagcgcccagactgaggcctgctaccacatgctgagccgg
ccccagccgccacccgaccccctcctgctccagcgtctgccacggcccagctccctgtca
gacaagacccagctccacagcaggtggctggactcgtcgcggtgtctcatgcagcagggc
atcaaggccggggacgcactctggctgcgcttcaagtactacagcttcttcgatttggat
cccaagacagaccccgtgcggctgacacagctgtatgagcaggcccggtgggacctgctg
ctggaggagattgactgcaccgaggaggagatgatggtgtttgccgccctgcagtaccac
atcaacaagctgtcccagagcggggaggtgggggagccggctggcacagacccagggctg
gacgacctggatgtggccctgagcaacctggaggtgaagctggaggggtcggcgcccaca
gatgtgctggacagcctcaccaccatcccagagctcaaggaccatctccgaatctttcgc
atcccacgaaggccccggaagctgaccctgaagggctaccgccaacactgggtggtgttc
aaggagaccacactgtcctactacaagagccaggacgaggcccctggggaccccattcag
cagctcaacctcaagggctgtgaggtggttcccgatgttaacgtctccggccagaagttc
tgcattaaactcctagtgccctcccctgagggcatgagtgagatctacctgcggtgccag
gatgagcagcagtatgcccgctggatggctggctgccgcctggcctccaaaggccgcacc
atggccgacagcagctacaccagcgaggtgcaggccatcctggccttcctcagcctgcag
cgcacgggcagtgggggcccgggcaaccacccccacggccctgatgcctctgccgagggc
ctcaacccctacggcctcgttgccccccgtttccagcgaaagttcaaggccaagcagctc
accccacggatcctggaagcccaccagaatgtggcccagttgtcgctggcagaggcccag
ctgcgcttcatccaggcctggcagtccctgcccgacttcggcatctcctatgtcatggtc
aggttcaagggcagcaggaaagacgagatcctgggcatcgccaacaaccgactgatccgc
atcgacttggccgtgggcgacgtggtcaagacctggcgtttcagcaacatgcgccagtgg
aatgtcaactgggacatccggcaggtggccatcgagtttgatgaacacatcaatgtggcc
ttcagctgcgtgtctgccagctgccgaattgtacacgagtatatcgggggctacattttc
ctgtcgacgcgggagcgggcccgtggggaggagctggatgaagacctcttcctgcagctc
accgggggccatgaggccttctga

DBGET integrated database retrieval system