KEGG   Homo sapiens (human): 83852Help
Entry
83852             CDS       T01001                                 

Gene name
SETDB2, C13orf4, CLLD8, CLLL8, KMT1F
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    83852 (SETDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    83852 (SETDB2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     83852 (SETDB2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     83852 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    83852 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD MBD_C
Motif
Other DBs
NCBI-GeneID: 83852
NCBI-ProteinID: NP_114121
OMIM: 607865
HGNC: 20263
Ensembl: ENSG00000136169
Vega: OTTHUMG00000016918
Pharos: Q96T68(Tbio)
UniProt: Q96T68
LinkDB All DBs
Structure
PDB: 

Position
13q14.2
AA seq 719 aa AA seqDB search
MGEKNGDAKTFWMELEDDGKVDFIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVNEAT
IINSSTSIKGASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTENKE
ILSLEDKVVDFREKDSSSNLSYQSHDCSGACLMKMPLNLKGENPLQLPIKCHFQRRHAKT
NSHSSALHVSYKTPCGRSLRNVEEVFRYLLETECNFLFTDNFSFNTYVQLARNYPKQKEV
VSDVDISNGVESVPISFCNEIDSRKLPQFKYRKTVWPRAYNLTNFSSMFTDSCDCSEGCI
DITKCACLQLTARNAKTSPLSSDKITTGYKYKRLQRQIPTGIYECSLLCKCNRQLCQNRV
VQHGPQVRLQVFKTEQKGWGVRCLDDIDRGTFVCIYSGRLLSRANTEKSYGIDENGRDEN
TMKNIFSKKRKLEVACSDCEVEVLPLGLETHPRTAKTEKCPPKFSNNPKELTVETKYDNI
SRIQYHSVIRDPESKTAIFQHNGKKMEFVSSESVTPEDNDGFKPPREHLNSKTKGAQKDS
SSNHVDEFEDNLLIESDVIDITKYREETPPRSRCNQATTLDNQNIKKAIEVQIQKPQEGR
STACQRQQVFCDEELLSETKNTSSDSLTKFNKGNVFLLDATKEGNVGRFLNHSCCPNLLV
QNVFVETHNRNFPLVAFFTNRYVKARTELTWDYGYEAGTVPEKEIFCQCGVNKCRKKIL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggcgatgcaaaaactttctggatggagctagaagatgatggaaaa
gtggacttcatttttgaacaagtacaaaatgtgctgcagtcactgaaacaaaagatcaaa
gatgggtctgccaccaataaagaatacatccaagcaatgattctagtgaatgaagcaact
ataattaacagttcaacatcaataaagggagcatcacagaaagaagtgaatgcccaaagc
agtgatcctatgcctgtgactcagaaggaacaggaaaacaaatccaatgcatttccctct
acatcatgtgaaaactcctttccagaagactgtacatttctaacaacagaaaataaggaa
attctctctcttgaagataaagttgtagactttagagaaaaagactcatcttcgaattta
tcttaccaaagtcatgactgctctggtgcttgtctgatgaaaatgccactgaacttgaag
ggagaaaaccctctgcagctgccaatcaaatgtcacttccaaagacgacatgcaaagaca
aactctcattcttcagcactccacgtgagttataaaaccccttgtggaaggagtctacga
aacgtggaggaagtttttcgttacctgcttgagacagagtgtaactttttatttacagat
aacttttctttcaatacctatgttcagttggctcggaattacccaaagcaaaaagaagtt
gtttctgatgtggatattagcaatggagtggaatcagtgcccatttctttctgtaatgaa
attgacagtagaaagctcccacagtttaagtacagaaagactgtgtggcctcgagcatat
aatctaaccaacttttccagcatgtttactgattcctgtgactgctctgagggctgcata
gacataacaaaatgtgcatgtcttcaactgacagcaaggaatgccaaaacttcccccttg
tcaagtgacaaaataaccactggatataaatataaaagactacagagacagattcctact
ggcatttatgaatgcagccttttgtgcaaatgtaatcgacaattgtgtcaaaaccgagtt
gtccaacatggtcctcaagtgaggttacaggtgttcaaaactgagcagaagggatggggt
gtacgctgtctagatgacattgacagagggacatttgtttgcatttattcaggaagatta
ctaagcagagctaacactgaaaaatcttatggtattgatgaaaacgggagagatgagaat
actatgaaaaatatattttcaaaaaagaggaaattagaagttgcatgttcagattgtgaa
gttgaagttctcccattaggattggaaacacatcctagaactgctaaaactgagaaatgt
ccaccaaagttcagtaataatcccaaggagcttactgtggaaacgaaatatgataatatt
tcaagaattcaatatcattcagttattagagatcctgaatccaagacagccatttttcaa
cacaatgggaaaaaaatggaatttgtttcctcggagtctgtcactccagaagataatgat
ggatttaaaccaccccgagagcatctgaactctaaaaccaagggagcacaaaaggactca
agttcaaaccatgttgatgagtttgaagataatctgctgattgaatcagatgtgatagat
ataactaaatatagagaagaaactccaccaaggagcagatgtaaccaggcgaccacattg
gataatcagaatattaaaaaggcaattgaggttcaaattcagaaaccccaagagggacga
tctacagcatgtcaaagacagcaggtattttgtgatgaagagttgctaagtgaaaccaag
aatacttcatctgattctctaacaaagttcaataaagggaatgtgtttttattggatgcc
acaaaagaaggaaatgtcggccgcttccttaatcatagttgttgcccaaatctcttggta
cagaatgtttttgtagaaacacacaacaggaattttccattggtggcattcttcaccaac
aggtatgtgaaagcaagaacagagctaacatgggattatggctatgaagctgggactgtg
cctgagaaggaaatcttctgccaatgtggggttaataaatgtagaaaaaaaatattataa

DBGET integrated database retrieval system