KEGG   Homo sapiens (human): 83872Help
Entry
83872             CDS       T01001                                 

Gene name
HMCN1, ARMD1, FBLN6, FIBL-6, FIBL6
Definition
(RefSeq) hemicentin 1
  KO
K17341  hemicentin
Organism
hsa  Homo sapiens (human)
Disease
H00821  Age-related macular degeneration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    83872 (HMCN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig V-set C2-set_2 Ig_6 Ig_5 EGF_CA TSP_1 G2F cEGF Receptor_2B4 FXa_inhibition EGF_3 EGF
Motif
Other DBs
NCBI-GeneID: 83872
NCBI-ProteinID: NP_114141
OMIM: 608548
HGNC: 19194
Ensembl: ENSG00000143341
Vega: OTTHUMG00000059337
Pharos: Q96RW7(Tbio)
UniProt: Q96RW7
LinkDB All DBs
Position
1q25.3-q31.1
AA seq 5635 aa AA seqDB search
MISWEVVHTVFLFALLYSSLAQDASPQSEIRAEEIPEGASTLAFVFDVTGSMYDDLVQVI
EGASKILETSLKRPKRPLFNFALVPFHDPEIGPVTITTDPKKFQYELRELYVQGGGDCPE
MSIGAIKIALEISLPGSFIYVFTDARSKDYRLTHEVLQLIQQKQSQVVFVLTGDCDDRTH
IGYKVYEEIASTSSGQVFHLDKKQVNEVLKWVEEAVQASKVHLLSTDHLEQAVNTWRIPF
DPSLKEVTVSLSGPSPMIEIRNPLGKLIKKGFGLHELLNIHNSAKVVNVKEPEAGMWTVK
TSSSGRHSVRITGLSTIDFRAGFSRKPTLDFKKTVSRPVQGIPTYVLLNTSGISTPARID
LLELLSISGSSLKTIPVKYYPHRKPYGIWNISDFVPPNEAFFLKVTGYDKDDYLFQRVSS
VSFSSIVPDAPKVTMPEKTPGYYLQPGQIPCSVDSLLPFTLSFVRNGVTLGVDQYLKESA
SVNLDIAKVTLSDEGFYECIAVSSAGTGRAQTFFDVSEPPPVIQVPNNVTVTPGERAVLT
CLIISAVDYNLTWQRNDRDVRLAEPARIRTLANLSLELKSVKFNDAGEYHCMVSSEGGSS
AASVFLTVQEPPKVTVMPKNQSFTGGSEVSIMCSATGYPKPKIAWTVNDMFIVGSHRYRM
TSDGTLFIKNAAPKDAGIYGCLASNSAGTDKQNSTLRYIEAPKLMVVQSELLVALGDITV
MECKTSGIPPPQVKWFKGDLELRPSTFLIIDPLLGLLKIQETQDLDAGDYTCVAINEAGR
ATGKITLDVGSPPVFIQEPADVSMEIGSNVTLPCYVQGYPEPTIKWRRLDNMPIFSRPFS
VSSISQLRTGALFILNLWASDKGTYICEAENQFGKIQSETTVTVTGLVAPLIGISPSVAN
VIEGQQLTLPCTLLAGNPIPERRWIKNSAMLLQNPYITVRSDGSLHIERVQLQDGGEYTC
VASNVAGTNNKTTSVVVHVLPTIQHGQQILSTIEGIPVTLPCKASGNPKPSVIWSKKGEL
ISTSSAKFSAGADGSLYVVSPGGEESGEYVCTATNTAGYAKRKVQLTVYVRPRVFGDQRG
LSQDKPVEISVLAGEEVTLPCEVKSLPPPIITWAKETQLISPFSPRHTFLPSGSMKITET
RTSDSGMYLCVATNIAGNVTQAVKLNVHVPPKIQRGPKHLKVQVGQRVDIPCNAQGTPLP
VITWSKGGSTMLVDGEHHVSNPDGTLSIDQATPSDAGIYTCVATNIAGTDETEITLHVQE
PPTVEDLEPPYNTTFQERVANQRIEFPCPAKGTPKPTIKWLHNGRELTGREPGISILEDG
TLLVIASVTPYDNGEYICVAVNEAGTTERKYNLKVHVPPVIKDKEQVTNVSVLLNQLTNL
FCEVEGTPSPIIMWYKDNVQVTESSTIQTVNNGKILKLFRATPEDAGRYSCKAINIAGTS
QKYFNIDVLVPPTIIGTNFPNEVSVVLNRDVALECQVKGTPFPDIHWFKDGKPLFLGDPN
VELLDRGQVLHLKNARRNDKGRYQCTVSNAAGKQAKDIKLTIYIPPSIKGGNVTTDISVL
INSLIKLECETRGLPMPAITWYKDGQPIMSSSQALYIDKGQYLHIPRAQVSDSATYTCHV
ANVAGTAEKSFHVDVYVPPMIEGNLATPLNKQVVIAHSLTLECKAAGNPSPILTWLKDGV
PVKANDNIRIEAGGKKLEIMSAQEIDRGQYICVATSVAGEKEIKYEVDVLVPPAIEGGDE
TSYFIVMVNNLLELDCHVTGSPPPTIMWLKDGQLIDERDGFKILLNGRKLVIAQAQVSNT
GLYRCMAANTAGDHKKEFEVTVHVPPTIKSSGLSERVVVKYKPVALQCIANGIPNPSITW
LKDDQPVNTAQGNLKIQSSGRVLQIAKTLLEDAGRYTCVATNAAGETQQHIQLHVHEPPS
LEDAGKMLNETVLVSNPVQLECKAAGNPVPVITWYKDNRLLSGSTSMTFLNRGQIIDIES
AQISDAGIYKCVAINSAGATELFYSLQVHVAPSISGSNNMVAVVVNNPVRLECEARGIPA
PSLTWLKDGSPVSSFSNGLQVLSGGRILALTSAQISDTGRYTCVAVNAAGEKQRDIDLRV
YVPPNIMGEEQNVSVLISQAVELLCQSDAIPPPTLTWLKDGHPLLKKPGLSISENRSVLK
IEDAQVQDTGRYTCEATNVAGKTEKNYNVNIWVPPNIGGSDELTQLTVIEGNLISLLCES
SGIPPPNLIWKKKGSPVLTDSMGRVRILSGGRQLQISIAEKSDAALYSCVASNVAGTAKK
EYNLQVYIRPTITNSGSHPTEIIVTRGKSISLECEVQGIPPPTVTWMKDGHPLIKAKGVE
ILDEGHILQLKNIHVSDTGRYVCVAVNVAGMTDKKYDLSVHAPPSIIGNHRSPENISVVE
KNSVSLTCEASGIPLPSITWFKDGWPVSLSNSVRILSGGRMLRLMQTTMEDAGQYTCVVR
NAAGEERKIFGLSVLVPPHIVGENTLEDVKVKEKQSVTLTCEVTGNPVPEITWHKDGQPL
QEDEAHHIISGGRFLQITNVQVPHTGRYTCLASSPAGHKSRSFSLNVFVSPTIAGVGSDG
NPEDVTVILNSPTSLVCEAYSYPPATITWFKDGTPLESNRNIRILPGGRTLQILNAQEDN
AGRYSCVATNEAGEMIKHYEVKVYIPPIINKGDLWGPGLSPKEVKIKVNNTLTLECEAYA
IPSASLSWYKDGQPLKSDDHVNIAANGHTLQIKEAQISDTGRYTCVASNIAGEDELDFDV
NIQVPPSFQKLWEIGNMLDTGRNGEAKDVIINNPISLYCETNAAPPPTLTWYKDGHPLTS
SDKVLILPGGRVLQIPRAKVEDAGRYTCVAVNEAGEDSLQYDVRVLVPPIIKGANSDLPE
EVTVLVNKSALIECLSSGSPAPRNSWQKDGQPLLEDDHHKFLSNGRILQILNTQITDIGR
YVCVAENTAGSAKKYFNLNVHVPPSVIGPKSENLTVVVNNFISLTCEVSGFPPPDLSWLK
NEQPIKLNTNTLIVPGGRTLQIIRAKVSDGGEYTCIAINQAGESKKKFSLTVYVPPSIKD
HDSESLSVVNVREGTSVSLECESNAVPPPVITWYKNGRMITESTHVEILADGQMLHIKKA
EVSDTGQYVCRAINVAGRDDKNFHLNVYVPPSIEGPEREVIVETISNPVTLTCDATGIPP
PTIAWLKNHKRIENSDSLEVRILSGGSKLQIARSQHSDSGNYTCIASNMEGKAQKYYFLS
IQVPPSVAGAEIPSDVSVLLGENVELVCNANGIPTPLIQWLKDGKPIASGETERIRVSAN
GSTLNIYGALTSDTGKYTCVATNPAGEEDRIFNLNVYVTPTIRGNKDEAEKLMTLVDTSI
NIECRATGTPPPQINWLKNGLPLPLSSHIRLLAAGQVIRIVRAQVSDVAVYTCVASNRAG
VDNKHYNLQVFAPPNMDNSMGTEEITVLKGSSTSMACITDGTPAPSMAWLRDGQPLGLDA
HLTVSTHGMVLQLLKAETEDSGKYTCIASNEAGEVSKHFILKVLEPPHINGSEEHEEISV
IVNNPLELTCIASGIPAPKMTWMKDGRPLPQTDQVQTLGGGEVLRISTAQVEDTGRYTCL
ASSPAGDDDKEYLVRVHVPPNIAGTDEPRDITVLRNRQVTLECKSDAVPPPVITWLRNGE
RLQATPRVRILSGGRYLQINNADLGDTANYTCVASNIAGKTTREFILTVNVPPNIKGGPQ
SLVILLNKSTVLECIAEGVPTPRITWRKDGAVLAGNHARYSILENGFLHIQSAHVTDTGR
YLCMATNAAGTDRRRIDLQVHVPPSIAPGPTNMTVIVNVQTTLACEATGIPKPSINWRKN
GHLLNVDQNQNSYRLLSSGSLVIISPSVDDTATYECTVTNGAGDDKRTVDLTVQVPPSIA
DEPTDFLVTKHAPAVITCTASGVPFPSIHWTKNGIRLLPRGDGYRILSSGAIEILATQLN
HAGRYTCVARNAAGSAHRHVTLHVHEPPVIQPQPSELHVILNNPILLPCEATGTPSPFIT
WQKEGINVNTSGRNHAVLPSGGLQISRAVREDAGTYMCVAQNPAGTALGKIKLNVQVPPV
ISPHLKEYVIAVDKPITLSCEADGLPPPDITWHKDGRAIVESIRQRVLSSGSLQIAFVQP
GDAGHYTCMAANVAGSSSTSTKLTVHVPPRIRSTEGHYTVNENSQAILPCVADGIPTPAI
NWKKDNVLLANLLGKYTAEPYGELILENVVLEDSGFYTCVANNAAGEDTHTVSLTVHVLP
TFTELPGDVSLNKGEQLRLSCKATGIPLPKLTWTFNNNIIPAHFDSVNGHSELVIERVSK
EDSGTYVCTAENSVGFVKAIGFVYVKEPPVFKGDYPSNWIEPLGGNAILNCEVKGDPTPT
IQWNRKGVDIEISHRIRQLGNGSLAIYGTVNEDAGDYTCVATNEAGVVERSMSLTLQSPP
IITLEPVETVINAGGKIILNCQATGEPQPTITWSRQGHSISWDDRVNVLSNNSLYIADAQ
KEDTSEFECVARNLMGSVLVRVPVIVQVHGGFSQWSAWRACSVTCGKGIQKRSRLCNQPL
PANGGKPCQGSDLEMRNCQNKPCPVDGSWSEWSLWEECTRSCGRGNQTRTRTCNNPSVQH
GGRPCEGNAVEIIMCNIRPCPVHGAWSAWQPWGTCSESCGKGTQTRARLCNNPPPAFGGS
YCDGAETQMQVCNERNCPIHGKWATWASWSACSVSCGGGARQRTRGCSDPVPQYGGRKCE
GSDVQSDFCNSDPCPTHGNWSPWSGWGTCSRTCNGGQMRRYRTCDNPPPSNGGRACGGPD
SQIQRCNTDMCPVDGSWGSWHSWSQCSASCGGGEKTRKRLCDHPVPVKGGRPCPGDTTQV
TRCNVQACPGGPQRARGSVIGNINDVEFGIAFLNATITDSPNSDTRIIRAKITNVPRSLG
SAMRKIVSILNPIYWTTAKEIGEAVNGFTLTNAVFKRETQVEFATGEILQMSHIARGLDS
DGSLLLDIVVSGYVLQLQSPAEVTVKDYTEDYIQTGPGQLYAYSTRLFTIDGISIPYTWN
HTVFYDQAQGRMPFLVETLHASSVESDYNQIEETLGFKIHASISKGDRSNQCPSGFTLDS
VGPFCADEDECAAGNPCSHSCHNAMGTYYCSCPKGLTIAADGRTCQDIDECALGRHTCHA
GQDCDNTIGSYRCVVRCGSGFRRTSDGLSCQDINECQESSPCHQRCFNAIGSFHCGCEPG
YQLKGRKCMDVNECRQNVCRPDQHCKNTRGGYKCIDLCPNGMTKAENGTCIDIDECKDGT
HQCRYNQICENTRGSYRCVCPRGYRSQGVGRPCMDINECEQVPKPCAHQCSNTPGSFKCI
CPPGQHLLGDGKSCAGLERLPNYGTQYSSYNLARFSPVRNNYQPQQHYRQYSHLYSSYSE
YRNSRTSLSRTRRTIRKTCPEGSEASHDTCVDIDECENTDACQHECKNTFGSYQCICPPG
YQLTHNGKTCQDIDECLEQNVHCGPNRMCFNMRGSYQCIDTPCPPNYQRDPVSGFCLKNC
PPNDLECALSPYALEYKLVSLPFGIATNQDLIRLVAYTQDGVMHPRTTFLMVDEEQTVPF
ALRDENLKGVVYTTRPLREAETYRMRVRASSYSANGTIEYQTTFIVYIAVSAYPY
NT seq 16908 nt NT seq  +upstreamnt  +downstreamnt
atgatttcctgggaagttgtccatacagtattcctgtttgctcttctttattcttcccta
gctcaagatgcgagcccccagtcagagatcagagctgaggaaattcccgagggggcctcc
acgttggcttttgtgtttgatgtgactggttctatgtatgatgatttagttcaggtgatt
gaaggggcttccaaaattttggagacgtctttgaaaagacctaaaagacctcttttcaac
tttgcgttggtgcctttccatgatccagaaattggcccagtgacaattaccacagatccc
aagaaatttcaatatgaactcagagaactgtatgttcagggtggtggtgattgcccagaa
atgagtattggagctataaaaattgccttggaaatttctcttcctggttctttcatctat
gttttcactgatgctcggtccaaagattaccggctcacccatgaggtgctgcaacttatc
caacagaaacagtcacaagtcgtatttgttctgactggagattgtgatgacaggacccat
attggatataaagtctatgaagaaattgcctctacaagttctggtcaagtgttccatctg
gacaaaaaacaagttaatgaggtattaaaatgggtagaagaagcagtacaggcctccaaa
gttcaccttttatccacagatcatttggaacaggctgtaaatacttggagaattcctttt
gatcccagcctgaaagaggtcactgtgtctttgagtgggccttctccaatgattgaaatt
cgcaatcctttagggaagctgataaaaaagggatttggcctgcatgagctattaaatatc
cataactctgccaaagtagtgaatgtgaaagagccagaggctggaatgtggacagtgaag
acctcaagcagtggaaggcactctgttcgcattactggcctcagtactattgatttccga
gctggcttttctcgaaagcccaccctggacttcaaaaaaacagtcagcagaccagtgcaa
ggaatacctacctatgtactgctcaatacttctggaatttccactccagctagaatagat
cttcttgaacttttgagtatctcaggaagttctcttaagactattcctgttaaatattac
ccacatcgaaaaccttatggcatatggaatatttctgactttgtaccaccaaatgaagct
ttctttctcaaagtaacaggctatgataaagatgattacctcttccagagagtatcaagt
gtttccttttctagtattgtcccagatgctcccaaagttacgatgcctgagaaaacccca
ggatactatctgcagccgggccaaattccctgctctgttgacagtcttttgccctttacc
ttgagctttgtcagaaatggagttacacttggagtagaccagtatttgaaagaatctgcc
agtgtgaacttagatattgcaaaggtcactttgtctgacgaaggtttctatgaatgcatt
gctgtcagcagtgcaggtactggacgggcacagacattttttgacgtatcagagccccct
ccggtcatccaagtgcctaacaatgttacagtcactcctggagagagagcagttttaaca
tgtctcatcatcagtgcggtggattacaatctaacctggcagaggaatgacagagatgtc
agactggcagagccagcgagaattaggaccttggctaatctgtcattggagctaaagagt
gtgaaattcaacgatgctggagagtatcattgtatggtttctagtgaaggtggatcatca
gccgcttcagttttcctcacagtgcaagaaccacccaaagtcactgtgatgcccaagaat
cagtctttcacaggagggtctgaggtctccatcatgtgttctgcaacaggttatcccaaa
ccaaagattgcctggaccgttaacgatatgtttatcgtgggttcacacaggtataggatg
acctcagatggtaccttatttatcaaaaatgcagctcccaaagatgcagggatctatggt
tgcctagcaagtaattcagctggaacagataaacagaattctactctcagatacattgaa
gcccctaagttgatggtagttcagagtgagctcttggttgcccttggggatataaccgtt
atggaatgcaaaacctctggtattcctccacctcaagttaaatggttcaaaggagatctt
gagttgaggccctcaacattcctcattattgaccctctcttgggacttttgaagattcaa
gaaacacaagatctggatgctggcgattatacctgtgtagccatcaatgaggctggaaga
gcaactggcaagataactctggatgttggctcacctccagttttcatacaagaacctgct
gatgtgtctatggaaattggctcaaatgtgacattaccttgttatgttcagggttatcca
gaaccaacaatcaaatggcgaagattagacaacatgccaattttctcaagacctttttca
gttagttccatcagccaactaagaacaggagctctctttattttaaacttatgggcaagt
gataaaggaacctatatttgtgaagctgaaaaccagtttggaaagatccagtcagagaca
acagtaacagtgaccggacttgttgctccacttattggaatcagcccttcagtggccaat
gttattgaaggacagcagcttactttgccctgtactctgttagctggaaatcccattcca
gaacgtcggtggattaagaattcagctatgttgctccaaaatccttacatcactgtgcgc
agtgatgggagcctccatattgaaagagttcagcttcaggatggtggtgaatatacttgt
gtggccagtaacgttgctgggaccaataacaaaactacctctgtggttgtgcatgttctg
ccaaccattcagcatgggcagcagatactcagtacaattgaaggcattccagtaacttta
ccatgcaaagcaagtggaaatcccaaaccgtctgtcatctggtccaagaaaggagagctg
atttcaaccagcagtgctaagttttcagcaggagctgatggtagtctgtatgtggtatca
cctggaggagaggagagtggggagtatgtctgcactgccaccaatacagccggctacgcc
aaaaggaaagtgcagctaacagtctatgtaaggcccagagtgtttggagatcaacgagga
ctgtcccaggataagcctgttgagatctccgtccttgcaggggaagaggtaacacttcca
tgtgaagtgaagagcttacctccacccataattacttgggccaaagaaacccagctcatc
tcaccgttctctccaagacacacattcctcccttctggttcaatgaagatcactgaaacc
cgcacttcagatagtgggatgtatctttgtgttgccacaaatattgctgggaatgtgact
caggctgtcaaattaaatgtccatgttcctccaaagatacagcgtggacctaaacatctc
aaagtccaagttggtcaaagagtggatattccatgtaatgctcaagggactcctcttcct
gtaatcacctggtccaaaggtggaagcactatgctggttgatggagagcaccatgttagc
aatccagacggaactttaagcatcgaccaagccacgccctcagatgctggcatatataca
tgtgttgctactaacatagcaggcactgatgaaacagagataacgctacatgtccaagaa
ccacccacagtggaagatctagaacctccatataacactactttccaagaaagagtggcc
aatcaacgcattgaatttccatgtcctgcaaaaggtacccctaaaccaaccatcaaatgg
ttacacaatggtagagagttgacaggcagagagcctggcatttctatcttggaagatggc
acattgctggttattgcttctgttacaccctatgacaatggggagtacatctgtgtggca
gtcaatgaagctggaaccacagaaagaaaatataacctcaaagtccatgttcctccagta
attaaagataaagaacaagttacaaatgtgtcggtgttgttaaatcagctgaccaatctc
ttctgtgaagtggaaggcactccatctcccatcattatgtggtataaagataatgtccag
gtgactgaaagcagcactattcagactgtgaacaatgggaagatactgaagctcttcaga
gccactccagaggatgcaggaagatattcctgcaaagcaattaatattgcaggcacttct
cagaagtactttaacattgatgtgctagttccacccaccataataggtaccaacttccca
aatgaagtctcagttgtcctcaaccgtgacgtcgcccttgaatgccaggtcaaaggcact
ccctttcctgatattcattggttcaaagatggcaagcctttatttttgggcgatcctaat
gttgaacttctagacagaggacaagtcttacatttaaagaatgcacggagaaatgacaag
gggcgctaccaatgtactgtgtctaatgcagctggcaaacaagccaaggatataaaactg
actatctatattccacctagtattaaaggaggaaatgtcaccacagacatatcagtattg
atcaacagccttattaaactggaatgtgaaacacggggacttccaatgcctgccattact
tggtataaggacgggcagccaatcatgtccagctcacaagcactttatattgataaagga
caatatcttcatattcctcgagcacaggtctctgattcagcaacatatacgtgtcatgta
gccaatgttgctggaactgctgaaaaatcattccatgtggatgtctatgttcctccaatg
attgaaggcaacttggccacgcctttgaataagcaagtagttattgctcattctctgaca
ctggagtgcaaagctgctggaaacccttctcccattctcacctggttgaaagatggtgta
cctgtgaaagctaatgacaatatccgcatagaagctggtgggaagaaactcgaaatcatg
agtgcccaagaaattgatcgaggacagtacatatgcgtggctaccagtgtggcaggagaa
aaggaaatcaaatatgaagttgatgtcttggtgccaccagctatagaaggaggagatgaa
acatcttacttcattgtgatggttaataacttactggagctagattgtcatgtgacaggc
tctcccccaccaactatcatgtggctgaaggatggccagttaattgatgaaagggatgga
ttcaagattttattaaatggacgcaaactggttattgctcaggctcaagtgtcaaacaca
ggcctttatcggtgcatggcagcaaatactgctggagaccacaagaaggaatttgaagtg
actgttcatgttcctccaacaatcaagtcctcaggcctttctgagagagttgtggtaaaa
tacaagcctgtcgccttgcagtgcatagccaatgggattccaaatccttccattacatgg
ttaaaagatgaccagcctgtgaacactgcccaaggaaaccttaaaatacagtcttctggt
cgagttctacaaattgccaaaaccctgttggaagatgctggcagatacacatgtgtggct
accaacgcagctggagaaacacaacagcacattcaactgcatgttcatgaaccacctagt
ctggaagatgctggaaaaatgctgaatgagactgtgttggtgagcaaccctgtacagctg
gagtgtaaggcagctggaaatcctgtgcctgttattacatggtacaaagataatcgtcta
ctctcaggttccaccagcatgactttcttgaacagaggacagatcattgatattgaaagt
gcccagatctcagatgctggcatatataaatgcgtggccatcaactcagctggagctaca
gagttattttacagtctgcaagttcatgtggccccatcaatttctggcagcaataacatg
gtggcagtggtggttaataacccggtgaggttagaatgtgaagccagaggtattcctgcc
ccaagtctgacctggttgaaagatgggagtcctgtttctagtttttctaatggattacag
gttctctctggtggtcgaatcctagcattgaccagtgcacaaatcagcgacacaggaagg
tacacctgcgtggcagtgaatgctgctggagaaaagcaaagggacattgacctccgagta
tatgttccgccaaatattatgggagaagaacagaatgtctctgtcctcattagccaagct
gtggaattactatgtcaaagtgatgctattcccccacctactcttacttggttaaaagac
ggccaccccttgctgaagaaaccaggcctcagtatatctgaaaatagaagtgtgttaaag
attgaagatgctcaggttcaagacactggtcgttacacttgtgaagcaacaaatgttgct
ggaaaaactgaaaaaaactacaatgtcaacatttgggtccccccaaatattggtggttct
gatgaacttactcaacttacagtcattgaagggaatctcattagtctgttgtgtgaatca
agtggtattccacccccaaatctcatctggaagaagaaaggctctccagtgctgactgat
tccatggggcgagttagaattttatctgggggcaggcaattacaaatttcaattgctgaa
aagtctgatgcagcactctattcatgtgtggcgtcgaatgttgctgggactgcaaagaaa
gaatacaatctgcaagtttacattagaccaaccataaccaacagtggcagccaccctact
gaaattattgtgacccgagggaagagtatctccttggagtgtgaggtgcagggtattcca
ccaccaacagtgacctggatgaaagatggccaccccttgatcaaggcaaagggagtagaa
atactggatgaaggtcacatccttcagctgaagaacattcatgtatctgacacaggccgt
tatgtgtgtgttgctgtgaatgtagcaggaatgactgacaaaaaatatgacttaagtgtc
catgctcctccaagcatcataggaaaccacaggtcacctgaaaatattagtgtggtagaa
aagaactcagtatctttgacttgtgaagcttctggaattcccctgccttccataacctgg
ttcaaagatgggtggcctgtcagccttagcaattctgtgaggattctttcaggaggcagg
atgctacggctgatgcagaccacaatggaagatgctggccaatatacttgcgttgtaagg
aatgcagctggtgaagaaagaaaaatctttgggctttcagtattagtaccacctcatatt
gtgggtgaaaatacattggaagatgtgaaggtaaaagagaaacagagtgttacgctgact
tgtgaagtgacagggaatccagtgccagaaattacatggcacaaagatgggcagcccctc
caagaagatgaagcccatcacattatatctggtggccgttttcttcaaattaccaatgtc
caggtgccacacactggaagatatacatgtttggcttccagtccagctggccacaagagc
aggagcttcagtcttaatgtatttgtatctcctacaattgctggtgtaggtagtgatggc
aaccctgaagatgtcactgtcatccttaacagccctacatctttggtctgtgaagcttat
tcatatcctccagctaccatcacctggtttaaggatggcactcctttagaatctaaccga
aatattcgtattcttccaggaggcagaactctgcagatcctcaatgcacaggaggacaat
gctggaagatactcttgtgtagccacgaatgaggctggagaaatgataaagcactatgaa
gtgaaggtgtacattccacccataatcaataaaggggacctttgggggccaggtctttcc
cctaaagaagtgaagatcaaagtaaacaacactctgaccttggaatgtgaagcgtatgca
attccttctgcctccctcagctggtacaaggatggacagccccttaaatccgatgatcat
gttaatattgctgcgaatggacacacacttcaaataaaggaggctcaaatatcagacacc
ggacgatatacttgtgtagcatctaacattgcaggtgaagatgagttggattttgatgtg
aatattcaagttcctccaagttttcagaaactctgggaaataggaaacatgctagatact
ggcaggaatggtgaagccaaagatgtgatcatcaacaatcccatttctctttactgtgag
acaaatgctgctccccctcctacactgacatggtacaaagatggccaccctctgacctca
agtgataaagtattgattttgccaggagggcgagtgttgcagattcctcgggctaaagta
gaagatgctgggagatacacatgtgtggctgtgaatgaggctggagaagattcccttcaa
tatgatgtccgtgtactcgtgccgccaattatcaagggagcaaatagtgatctccctgaa
gaggtcaccgtgctggtgaacaagagtgcactgatagagtgtttatccagtggcagccca
gcaccaaggaattcctggcagaaagatggacagcccttgctagaagatgaccatcataaa
tttctatctaatggacgaattctgcagattctgaatactcaaataacagatatcggcagg
tatgtgtgtgttgctgagaacacagctgggagtgccaaaaaatattttaacctcaatgtt
catgttcctccaagtgtcattggtcctaaatctgaaaatcttaccgtcgtggtgaacaat
ttcatctctttgacctgtgaggtctctggttttccacctcctgacctcagctggctcaag
aatgaacagcccatcaaactgaacacaaatactctcattgtgcctggtggtcgaactcta
cagattattcgggccaaggtatcagatggtggtgaatacacttgtatagctatcaatcaa
gctggcgaaagcaagaaaaagttttccctgactgtttatgtgcccccaagcattaaagac
catgacagtgaatctctttctgtagttaatgtaagagagggaacttctgtgtctttggag
tgtgagtcgaacgctgtgccacctccagtcatcacttggtataagaatgggcggatgata
acagagtctactcatgtggagattttagctgatggacaaatgctacacattaagaaagct
gaggtatctgacacaggccagtatgtatgtagagctataaatgtagcaggacgggatgat
aaaaatttccacctcaatgtatatgtgccacccagtattgaaggacctgaaagagaagtg
attgtggagacgatcagcaatcctgtgacattaacatgtgatgccactgggatcccacct
cccacgatagcatggttaaagaaccacaagcgcatagaaaattctgactcactggaagtt
cgtattttgtctggaggtagcaaactccagattgcccggtctcagcattcagatagtgga
aactatacatgtattgcttcaaatatggagggaaaagcccagaaatattactttctttca
attcaagttcctccaagtgttgctggtgctgaaattccaagtgatgtcagtgtccttcta
ggagaaaatgttgagctggtctgcaatgcaaatggcattcctactccacttattcaatgg
cttaaagatggaaagcccatagctagtggtgaaacagaaagaatccgagtgagtgcaaat
ggcagcacattaaacatttatggagctcttacatctgacacggggaaatacacatgtgtt
gctactaatcccgctggagaagaagaccgaatttttaacttgaatgtctatgttacacct
acaattaggggtaataaagatgaagcagagaaactaatgactttagtggatacttcaata
aatattgaatgcagagccacagggacgcctccaccacagataaactggctgaagaatgga
cttcctctgcctctctcctcccatatccggttactggcagcaggacaagttatcaggatt
gtgagagctcaggtgtctgatgtcgctgtgtatacttgtgtggcctccaacagagctggg
gtggataataagcattacaatcttcaagtgtttgcaccaccaaatatggacaattcaatg
gggacagaggaaatcacagttctcaaaggtagttccacctctatggcatgcattactgat
ggaaccccagctcccagtatggcctggcttagagatggccagcctctggggcttgatgcc
catctgacagtcagcacccatggaatggtcctgcagctcctcaaagcagagactgaagat
tcgggaaagtacacctgcattgcctcaaatgaagctggagaagtcagcaagcactttatc
ctcaaggtcctagaaccacctcacattaatggatctgaagaacatgaagagatatcagta
attgttaataacccacttgaacttacctgcattgcttctggaatcccagcccctaaaatg
acctggatgaaagatggccggccccttccacagacggatcaagtgcaaactctaggagga
ggagaggttcttcgaatttctactgctcaggtggaggatacaggaagatatacatgtctg
gcatccagtcctgcaggagatgatgataaggaatatctagtgagagtgcatgtacctcct
aatattgctggaactgatgagccccgggatatcactgtgttacggaacagacaagtgaca
ttggaatgcaagtcagatgcagtgcccccacctgtaattacttggctcagaaatggagaa
cggttacaggcaacacctcgagtgcgaatcctatctggagggagatacttgcaaatcaac
aatgctgacctaggtgatacagccaattatacctgtgttgccagcaacattgcaggaaag
actacaagagaatttattctcactgtaaatgttcctccaaacataaaggggggcccccag
agccttgtaattcttttaaataagtcaactgtattggaatgcatcgctgaaggtgtgcca
actccaaggataacatggagaaaggatggagctgttctagctgggaatcatgcaagatat
tccatcttggaaaatggattccttcatattcaatcagcacatgtcactgacactggacgg
tatttgtgtatggccaccaatgctgctggaacagatcgcaggcgaatagatttacaggtc
catgttcctccatctattgctccgggtcctaccaacatgactgtaatagtaaatgttcaa
actactctggcttgtgaggctactgggataccaaaaccatcaatcaattggagaaaaaat
gggcatcttcttaatgtggatcaaaatcagaactcatacaggctcctttcttcaggttca
ctagtaattatttccccttctgtggatgacactgcaacctatgaatgtactgtgacaaac
ggtgctggagatgataaaagaactgtggatctcactgtccaagttccaccttccatagct
gatgagcctacagatttcctagtaaccaaacatgccccagcagtaattacctgcactgct
tcgggagttccatttccctcaattcactggaccaaaaatggtataagactgcttcccagg
ggagatggctatagaattctgtcctcaggagcaattgaaatacttgccacccaattaaac
catgctggaagatacacttgtgtcgctaggaatgcggctggctctgcacatcgacacgtg
acccttcatgttcatgagcctccagtcattcagccccaaccaagtgaactacacgtcatt
ctgaacaatcctattttattaccatgtgaagcaacagggacacccagtcctttcattact
tggcaaaaagaaggcatcaatgttaacacttcaggcagaaaccatgcagttcttcctagt
ggcggcttacagatctccagagctgtccgagaggatgctggcacttacatgtgtgtggcc
cagaacccggctggtacagccttgggcaaaatcaagttaaatgtccaagttcctccagtc
attagccctcatctaaaggaatatgttattgctgtggacaagcccatcacgttatcctgt
gaagcagatggcctccctccgcctgacattacatggcataaagatgggcgtgcaattgtg
gaatctatccgccagcgcgtcctcagctctggctctctgcaaatagcatttgtccagcct
ggtgatgctggccattacacgtgcatggcagccaatgtagcaggatcaagcagcacaagc
accaagctcaccgtccatgtaccacccaggatcagaagtacagaaggacactacacggtc
aatgagaattcacaagccattcttccatgcgtagctgatggaatccccacaccagcaatt
aactggaaaaaagacaatgttcttttagctaacttgttaggaaaatacactgctgaacca
tatggagaactcattttagaaaatgttgtgctggaggattctggcttctatacctgtgtt
gctaacaatgctgcaggtgaagatacacacactgtcagcctgactgtgcatgttctcccc
acttttactgaacttcctggagacgtgtcattaaataaaggagaacagctacgattaagc
tgtaaagctactggtattccattgcccaaattaacatggaccttcaataacaatattatt
ccagcccactttgacagtgtgaatggacacagtgaacttgttattgaaagagtgtcaaaa
gaggattcaggtacttatgtgtgcaccgcagagaacagcgttggctttgtgaaggcaatt
ggatttgtttatgtgaaagaacctccagtcttcaaaggtgattatccttctaactggatt
gaaccacttggtgggaatgcaatcctgaattgtgaggtgaaaggagaccccaccccaacc
atccagtggaacagaaagggagtggatattgaaattagccacagaatccggcaactgggc
aatggctccctggccatctatggcactgttaatgaagatgccggtgactatacatgtgta
gctaccaatgaagctggggtggtggagcgcagcatgagtctgactctgcaaagtcctcct
attatcactcttgagccagtggaaactgttattaatgctggtggcaaaatcatattgaat
tgtcaggcaactggagagcctcaaccaaccattacatggtcccgtcaagggcactctatt
tcctgggatgaccgggttaacgtgttgtccaacaactcattatatattgctgatgctcag
aaagaagatacctctgaatttgaatgtgttgctcgaaacttaatgggttctgtccttgtc
agagtgccagtcatagtccaggttcatggtggattttcccagtggtctgcatggagagcc
tgcagtgtcacctgtggaaaaggcatccaaaagaggagtcgtctgtgcaaccagcccctt
ccagccaatggtgggaagccctgccaaggttcagatttggaaatgcgaaactgtcaaaat
aagccttgtccagtggatggtagctggtcggaatggagtctttgggaagaatgcacaagg
agctgtggacgcggcaaccaaaccaggaccaggacttgcaataatccatcagttcagcat
ggtgggcggccatgtgaagggaatgctgtggaaataattatgtgcaacattaggccttgc
ccagttcatggagcatggagcgcttggcagccttggggaacatgcagcgaaagttgtggg
aaaggtactcagacaagagcaagactttgtaataacccaccaccagcgtttggtgggtcc
tactgtgatggagcagaaacacagatgcaagtttgcaatgaaagaaattgtccaattcat
ggcaagtgggcgacttgggccagttggagtgcctgttctgtgtcatgtggaggaggtgcc
agacagagaacaaggggctgctccgaccctgtgccccagtatggaggaaggaaatgcgaa
gggagtgatgtccagagtgatttttgcaacagtgacccttgcccaacccatggtaactgg
agtccttggagtggctggggaacatgcagccggacgtgtaacggagggcagatgcggcgg
taccgcacatgtgataaccctcctccctccaatgggggaagagcttgtgggggaccagac
tcccagatccagaggtgcaacactgacatgtgtcctgtggatggaagttggggaagctgg
catagttggagccagtgctctgcctcctgtggaggaggtgaaaagactcggaagcggctg
tgcgaccatcctgtgccagttaaaggtggccgtccctgtcccggagacactactcaggtg
accaggtgcaatgtacaagcatgtccaggtgggccccagcgagccagaggaagtgttatt
ggaaatattaatgatgttgaatttggaattgctttccttaatgccacaataactgatagc
cctaactctgatactagaataatacgtgccaaaattaccaatgtacctcgtagtcttggt
tcagcaatgagaaagatagtttctattctaaatcccatttattggacaacagcaaaggaa
ataggagaagcagtcaatggctttaccctcaccaatgcagtcttcaaaagagaaactcaa
gtggaatttgcaactggagaaatcttgcagatgagtcatattgcccggggcttggattcc
gatggttctttgctgctagatatcgttgtgagtggctatgtcctacagcttcagtcacct
gctgaagtcactgtaaaggattacacagaggactacattcaaacaggtcctgggcagctg
tacgcctactcaacccggctgttcaccattgatggcatcagcatcccatacacatggaac
cacaccgttttctatgatcaggcacagggaagaatgcctttcttggttgaaacacttcat
gcatcctctgtggaatctgactataaccagatagaagagacactgggttttaaaattcat
gcttcaatatccaaaggagatcgcagtaatcagtgcccctccgggtttaccttagactca
gttggacctttttgtgctgatgaggatgaatgtgcagcagggaatccctgctcccatagc
tgccacaatgccatggggacttactactgctcctgccctaaaggcctcaccatagctgca
gatggaagaacttgtcaagatattgatgagtgtgctttgggtaggcatacctgccacgct
ggtcaggactgtgacaatacgattggatcttatcgctgtgtggtccgttgtggaagtggc
tttcgaagaacctctgatgggctgagttgtcaagatattaatgaatgtcaagaatccagc
ccctgtcaccagcgctgtttcaatgccataggaagtttccattgtggatgtgaacctggg
tatcagctcaaaggcagaaaatgcatggatgtgaacgagtgtagacaaaatgtatgcaga
ccagatcagcactgtaagaacacccgtggtggctataagtgcattgatctttgtccaaat
ggaatgaccaaggcagaaaatggaacctgtattgatattgatgaatgtaaagatgggacc
catcagtgcagatataaccagatatgtgagaatacaagaggcagctatcgttgtgtatgc
ccaagaggttatcggtctcaaggagttggaagaccctgcatggacattaatgaatgtgaa
caagtgcctaaaccttgtgcacatcagtgctccaacacccccggcagcttcaagtgtatc
tgtccaccaggacaacatttattaggggacgggaaatcttgcgctggattggagaggctg
ccaaattatggcactcaatacagtagctataaccttgcacggttctcccctgtgagaaac
aactatcaacctcaacagcattacagacagtactcacatctctacagctcctactcagag
tatagaaacagcagaacatctctctccaggactagaaggactattaggaaaacttgccct
gaaggctctgaggcaagccatgacacatgtgtagatattgatgaatgtgaaaatacagat
gcctgccagcatgagtgtaagaatacctttggaagttatcagtgcatctgcccacctggc
tatcaactcacacacaatggaaagacatgccaagatatcgatgaatgtctggagcagaat
gtgcactgtggacccaatcgcatgtgcttcaacatgagaggaagctaccagtgcatcgat
acaccctgtccacccaactaccaacgggatcctgtttcagggttctgcctcaagaactgt
ccacccaatgatttggaatgtgccttgagcccatatgccttggaatacaaactcgtctcc
ctcccatttggaatagccaccaatcaagatttaatccggctggttgcatacacacaggat
ggagtgatgcatcccaggacaactttcctcatggtagatgaggaacagactgttcctttt
gccttgagggatgaaaacctgaaaggagtggtgtatacaacacgaccactacgagaagca
gagacctaccgcatgagggtccgagcctcatcctacagtgccaatgggaccattgaatat
cagaccacattcatagtttatatagctgtgtccgcctatccatactaa

DBGET integrated database retrieval system