KEGG   Homo sapiens (human): 8398
Entry
8398              CDS       T01001                                 

Gene name
PLA2G6, CaI-PLA2, GVI, INAD1, IPLA2-VIA, NBIA2, NBIA2A, NBIA2B, PARK14, PLA2, PNPLA9, iPLA2, iPLA2beta
Definition
(RefSeq) phospholipase A2 group VI
  KO
K16343  calcium-independent phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04666  Fc gamma R-mediated phagocytosis
hsa04750  Inflammatory mediator regulation of TRP channels
Disease
H00057  Parkinson disease
H00833  Neurodegeneration with brain iron accumulation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    8398 (PLA2G6)
   00565 Ether lipid metabolism
    8398 (PLA2G6)
   00590 Arachidonic acid metabolism
    8398 (PLA2G6)
   00591 Linoleic acid metabolism
    8398 (PLA2G6)
   00592 alpha-Linolenic acid metabolism
    8398 (PLA2G6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    8398 (PLA2G6)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    8398 (PLA2G6)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    8398 (PLA2G6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    8398 (PLA2G6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    8398 (PLA2G6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     8398 (PLA2G6)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    8398 (PLA2G6)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank Ank_3 Patatin
Other DBs
NCBI-GeneID: 8398
NCBI-ProteinID: NP_003551
OMIM: 603604
HGNC: 9039
Ensembl: ENSG00000184381
Vega: OTTHUMG00000151246
Pharos: O60733(Tchem)
UniProt: O60733
LinkDB
Position
22q13.1
AA seq 806 aa
MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLV
NPRNSQSGFRLFQLELEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSW
SVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMD
VTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLL
LCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIHSKDPRYGASPLHWAKNAEMA
RMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANADARGEHGNTPLHLAMSK
DNVEMIKALIVFGAEVDTPNDFGETPTFLASKIGRLVTRKAILTLLRTVGAEYCFPPIHG
VPAEQGSAAPHHPFSLERAQPPPISLNNLELQDLMHISRARKPAFILGSMRDEKRTHDHL
LCLDGGGVKGLIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSMAYMRGM
YFRMKDEVFRGSRPYESGPLEEFLKREFGEHTKMTDVRKPKVMLTGTLSDRQPAELHLFR
NYDAPETVREPRFNQNVNLRPPAQPSDQLVWRAARSSGAAPTYFRPNGRFLDGGLLANNP
TLDAMTEIHEYNQDLIRKGQANKVKKLSIVVSLGTGRSPQVPVTCVDVFRPSNPWELAKT
VFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGTDIMLDEVSDTVLVN
ALWETEVYIYEHREEFQKLIQLLLSP
NT seq 2421 nt   +upstreamnt  +downstreamnt
atgcagttctttggccgcctggtcaataccttcagtggcgtcaccaacttgttctctaac
ccattccgggtgaaggaggtggctgtggccgactacacctcgagtgaccgagttcgggag
gaagggcagctgattctgttccagaacactcccaaccgcacctgggactgcgtcctggtc
aaccccaggaactcacagagtggattccgactcttccagctggagttggaggctgacgcc
ctagtgaatttccatcagtattcttcccagctgctacccttctatgagagctcccctcag
gtcctgcacactgaggtcctgcagcacctgaccgacctcatccgtaaccaccccagctgg
tcagtggcccacctggctgtggagctagggatccgcgagtgcttccatcacagccgtatc
atcagctgtgccaattgcgcggagaacgaggagggctgcacacccctgcacctggcctgc
cgcaagggtgatggggagatcctggtggagctggtgcagtactgccacactcagatggat
gtcaccgactacaagggagagaccgtcttccattatgctgtccagggtgacaattctcag
gtgctgcagctccttggaaggaacgcagtggctggcctgaaccaggtgaataaccaaggg
ctgaccccgctgcacctggcctgccagctggggaagcaggagatggtccgcgtgctgctg
ctgtgcaatgctcggtgcaacatcatgggccccaacggctaccccatccactcggccatg
aagttctctcagaaggggtgtgcggagatgatcatcagcatggacagcagccagatccac
agcaaagacccccgttacggagccagccccctccactgggccaagaacgcagagatggcc
cgcatgctgctgaaacggggctgcaacgtgaacagcaccagctccgcggggaacacggcc
ctgcacgtggcggtgatgcgcaaccgcttcgactgtgccatagtgctgctgacccacggg
gccaacgcggatgcccgcggagagcacggcaacaccccgctgcacctggccatgtcgaaa
gacaacgtggagatgatcaaggccctcatcgtgttcggagcagaagtggacaccccgaat
gactttggggagactcctacattcctagcctccaaaatcggcagacttgtcaccaggaag
gcgatcttgactctgctgagaaccgtgggggccgaatactgcttcccacccatccacggg
gtccccgcggagcagggctctgcagcgccacatcatcccttctccctggaaagagctcag
cccccaccgatcagcctaaacaacctagaactacaggatctcatgcacatctcacgggcc
cggaagccagcgttcatcctgggctccatgagggacgagaagcggacccacgaccacctg
ctgtgcctggatggaggaggagtgaaaggcctcatcatcatccagctcctcatcgccatc
gagaaggcctcgggtgtggccaccaaggacctgtttgactgggtggcgggcaccagcact
ggaggcatcctggccctggccattctgcacagtaagtccatggcctacatgcgcggcatg
tactttcgcatgaaggatgaggtgttccggggctccaggccctacgagtcggggcccctg
gaggagttcctgaagcgggagtttggggagcacaccaagatgacggacgtcaggaaaccc
aaggtgatgctgacagggacactgtctgaccggcagccggctgaactccacctcttccgg
aactacgatgctccagaaactgtccgggagcctcgtttcaaccagaacgttaacctcagg
cctccagctcagccctcagaccagctggtgtggcgggcggcccgaagcagcggggcagct
cctacttacttccgacccaatgggcgcttcctggacggtgggctgctggccaacaacccc
acgctggatgccatgaccgagatccatgagtacaatcaggacctgatccgcaagggtcag
gccaacaaggtgaagaaactctccatcgttgtctccctggggacagggaggtccccacaa
gtgcctgtgacctgtgtggatgtcttccgtcccagcaacccctgggagctggccaagact
gtttttggggccaaggaactgggcaagatggtggtggactgttgcacggatccagacggg
cgggctgtggaccgggcacgggcctggtgcgagatggtcggcatccagtacttcagattg
aacccccagctggggacggacatcatgctggatgaggtcagtgacacagtgctggtcaac
gccctctgggagaccgaggtctacatctatgagcaccgcgaggagttccagaagctcatc
cagctgctgctctcaccctga

DBGET integrated database retrieval system