KEGG   Homo sapiens (human): 840
Entry
840               CDS       T01001                                 

Gene name
CASP7, CASP-7, CMH-1, ICE-LAP3, LICE2, MCH3
Definition
(RefSeq) caspase 7
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04668  TNF signaling pathway
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05200  Pathways in cancer
Network
nt06131  Apoptosis (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
nt06231  Apoptosis
nt06260  Colorectal cancer
nt06263  Hepatocellular carcinoma
nt06267  Small cell lung cancer
nt06410  Calcium signaling
nt06414  Apoptosis
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00098  Intrinsic apoptotic pathway
N00100  BCL2-overexpression to intrinsic apoptotic pathway
N00145  Extrinsic apoptotic pathway
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00449  HIV Tat/Nef to crosstalk between extrinsic and intrinsic apoptotic pathways
N00450  HIV Tat to intrinsic apoptotic pathway
N00453  HIV Vpr to intrinsic apoptotic pathway
N00957  Mutation-caused abberant ATXN2/3 to mGluR5-Ca2+ -apoptotic pathway
N00967  VGCC-Ca2+ -apoptotic pathway
N00984  mGluR5-Ca2+ -apoptotic pathway
N00985  Mutation-caused aberrant Htt to mGluR5-Ca2+ -apoptotic pathway
N01007  Mutation-caused aberrant PSEN to mGluR5-Ca2+ -apoptotic pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    840 (CASP7)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    840 (CASP7)
   04215 Apoptosis - multiple species
    840 (CASP7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    840 (CASP7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    840 (CASP7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    840 (CASP7)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    840 (CASP7)
   05132 Salmonella infection
    840 (CASP7)
   05133 Pertussis
    840 (CASP7)
   05134 Legionellosis
    840 (CASP7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    840 (CASP7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     840 (CASP7)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C14: caspase family
   840 (CASP7)
SSDB
Motif
Pfam: Peptidase_C14 EZH2_N
Other DBs
NCBI-GeneID: 840
NCBI-ProteinID: NP_001218
OMIM: 601761
HGNC: 1508
Ensembl: ENSG00000165806
Vega: OTTHUMG00000019076
Pharos: P55210(Tchem)
UniProt: P55210
LinkDB
Structure
PDB: 

Position
10q25.3
AA seq 303 aa
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQY
NMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQ
DLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW
FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELY
FSQ
NT seq 912 nt   +upstreamnt  +downstreamnt
atggcagatgatcagggctgtattgaagagcagggggttgaggattcagcaaatgaagat
tcagtggatgctaagccagaccggtcctcgtttgtaccgtccctcttcagtaagaagaag
aaaaatgtcaccatgcgatccatcaagaccacccgggaccgagtgcctacatatcagtac
aacatgaattttgaaaagctgggcaaatgcatcataataaacaacaagaactttgataaa
gtgacaggtatgggcgttcgaaacggaacagacaaagatgccgaggcgctcttcaagtgc
ttccgaagcctgggttttgacgtgattgtctataatgactgctcttgtgccaagatgcaa
gatctgcttaaaaaagcttctgaagaggaccatacaaatgccgcctgcttcgcctgcatc
ctcttaagccatggagaagaaaatgtaatttatgggaaagatggtgtcacaccaataaag
gatttgacagcccactttaggggggatagatgcaaaacccttttagagaaacccaaactc
ttcttcattcaggcttgccgagggaccgagcttgatgatggcatccaggccgactcgggg
cccatcaatgacacagatgctaatcctcgatacaagatcccagtggaagctgacttcctc
ttcgcctattccacggttccaggctattactcgtggaggagcccaggaagaggctcctgg
tttgtgcaagccctctgctccatcctggaggagcacggaaaagacctggaaatcatgcag
atcctcaccagggtgaatgacagagttgccaggcactttgagtctcagtctgatgaccca
cacttccatgagaagaagcagatcccctgtgtggtctccatgctcaccaaggaactctac
ttcagtcaatag

DBGET integrated database retrieval system