KEGG   Homo sapiens (human): 84133Help
Entry
84133             CDS       T01001                                 

Gene name
ZNRF3, BK747E2.3, RNF203
Definition
(RefSeq) zinc and ring finger 3
  KO
K16273  E3 ubiquitin-protein ligase ZNRF3 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    84133 (ZNRF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    84133 (ZNRF3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     84133 (ZNRF3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    84133 (ZNRF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ZNRF_3_ecto zf-RING_2 zf-RING_11 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_5 zf-rbx1 Prok-RING_4 zf-C3HC4_3 zf-ANAPC11 PA Cadherin_C_2
Motif
Other DBs
NCBI-GeneID: 84133
NCBI-ProteinID: NP_001193927
OMIM: 612062
HGNC: 18126
Ensembl: ENSG00000183579
Vega: OTTHUMG00000151009
Pharos: Q9ULT6(Tbio)
UniProt: Q9ULT6 A0A024R1J1
LinkDB All DBs
Structure
PDB: 

Position
22q12.1
AA seq 936 aa AA seqDB search
MRPRSGGRPGATGRRRRRLRRRPRGLRCSRLPPPPPLPLLLGLLLAAAGPGAARAKETAF
VEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGW
VGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPV
VYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDMGIFLAFFVVVSLVCLILLVKI
KLKQRRSQNSMNRLAVQALEKMETRKFNSKSKGRREGSCGALDTLSSSSTSDCAICLEKY
IDGEELRVIPCTHRFHRKCVDPWLLQHHTCPHCRHNIIEQKGNPSAVCVETSNLSRGRQQ
RVTLPVHYPGRVHRTNAIPAYPTRTSMDSHGNPVTLLTMDRHGEQSLYSPQTPAYIRSYP
PLHLDHSLAAHRCGLEHRAYSPAHPFRRPKLSGRSFSKAACFSQYETMYQHYYFQGLSYP
EQEGQSPPSLAPRGPARAFPPSGSGSLLFPTVVHVAPPSHLESGSTSSFSCYHGHRSVCS
GYLADCPGSDSSSSSSSGQCHCSSSDSVVDCTEVSNQGVYGSCSTFRSSLSSDYDPFIYR
SRSPCRASEAGGSGSSGRGPALCFEGSPPPEELPAVHSHGAGRGEPWPGPASPSGDQVST
CSLEMNYSSNSSLEHRGPNSSTSEVGLEASPGAAPDLRRTWKGGHELPSCACCCEPQPSP
AGPSAGAAGSSTLFLGPHLYEGSGPAGGEPQSGSSQGLYGLHPDHLPRTDGVKYEGLPCC
FYEEKQVARGGGGGSGCYTEDYSVSVQYTLTEEPPPGCYPGARDLSQRIPIIPEDVDCDL
GLPSDCQGTHSLGSWGGTRGPDTPRPHRGLGATREEERALCCQARALLRPGCPPEEAGAV
RANFPSALQDTQESSTTATEAAGPRSHSADSSSPGA
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atgaggccgcgctcgggcgggcgcccaggggccacgggccgccgccgccgccgcctgcgc
cgccgcccccgcggcctccggtgcagccgcctgccgccgccgccgccgctgccgctgctg
ctcgggctgctgctggcggccgcggggcccggcgcggcgcgggccaaggagacggcgttc
gtggaggtggtgctgttcgagtcgagcccaagcggcgattacaccacctacaccaccggc
ctcacgggccgcttctcgcgggccggggccacgctcagcgccgagggcgagatcgtgcag
atgcacccactgggcctatgtaataacaatgacgaagaggacttgtatgaatatggctgg
gtaggagtggtgaagctggaacagccagaattggacccgaaaccatgcctcactgtccta
ggcaaggccaagcgagcagtacagcggggagctactgcagtcatctttgatgtgtctgaa
aacccagaagctattgatcagctgaaccagggctctgaagacccgctcaagaggccggtg
gtgtatgtgaagggtgcagatgccattaagctgatgaacatcgtcaacaagcagaaagtg
gctcgagcaaggatccagcaccgccctcctcgacaacccactgaatactttgacatgggg
attttcctggctttcttcgtcgtggtctccttggtctgcctcatcctccttgtcaaaatc
aagctgaagcagcgacgcagtcagaattccatgaacaggctggctgtgcaggctctagag
aagatggaaaccagaaagttcaactccaagagcaaggggcgccgggaggggagctgtggg
gccctggacacactcagcagcagctccacgtccgactgtgccatctgtctggagaagtac
attgatggagaggagctgcgggtcatcccctgtactcaccggtttcacaggaagtgcgtg
gacccctggctgctgcagcaccacacctgcccccactgtcggcacaacatcatagaacaa
aagggaaacccaagcgcggtgtgtgtggagaccagcaacctctcacgtggtcggcagcag
agggtgaccctgccggtgcattaccccggccgcgtgcacaggaccaacgccatcccagcc
taccctacgaggacaagcatggactcccacggcaaccccgtcaccttgctgaccatggac
cggcacggggagcagagcctctattccccgcagacccccgcctacatccgcagctaccca
cccctccacctggaccacagcctggccgctcaccgctgcggcctggagcaccgggcctac
tccccagcccaccccttccgcaggcccaagttgagtggccgcagcttctccaaggcagct
tgcttctcccagtatgagaccatgtaccagcactactacttccagggcctcagctacccg
gagcaggaggggcagtccccacctagcctcgcaccccggggcccggcccgtgcctttcct
ccgagcggcagtggcagcctgctcttccccaccgtggtgcacgtggccccgccctcccac
ctggagagcggcagcacgtccagcttcagctgctatcacggccaccgctcggtgtgcagt
ggctacctggccgactgcccaggcagcgacagcagcagcagcagcagctccggccagtgc
cactgttcctccagtgactctgtggtagactgcactgaggtcagcaaccagggcgtgtac
gggagctgctccaccttccgcagctccctcagcagcgactatgaccccttcatctaccgc
agccggagcccctgtcgtgccagtgaggcggggggctcgggcagctcgggccggggacct
gccctgtgcttcgagggctccccgcctcccgaggagctcccggcggtgcacagtcatggt
gctgggcggggcgagccttggccgggccctgcctctccctcgggggatcaggtgtccacc
tgcagcctggagatgaactacagcagcaactcctccctggagcacagggggcccaatagc
tctacctcagaagtggggctcgaggcttctcctggggccgcccctgacctcaggaggacc
tggaaggggggccacgagttgccgtcgtgtgcctgctgctgcgagccccagccctcccca
gccgggcctagcgccggagcagctggcagcagcaccttgttcctggggccccacctctac
gagggctctggcccggcgggtggggagccccagtcaggaagctcccagggcttgtacggc
cttcaccccgaccatttgcccaggacagatggggtgaaatacgagggtctgccctgctgc
ttctatgaagagaagcaggtggcccgcgggggcggagggggcagcggctgctacactgag
gactactcggtgagtgtgcagtacacgctcaccgaggaaccaccgcccggctgctacccc
ggggcccgggacctgagccagcgcatccccatcattccagaggatgtggactgtgatctg
ggcctgccctcggactgccaagggacccacagcctcggctcctggggtgggacgcgaggc
ccggataccccacggccccacaggggcctgggagcaacccgggaagaggagcgggctctg
tgctgccaggctagggccctactgcggcctggctgccctccggaggaggcgggtgctgtc
agggccaacttccctagtgccctccaggacactcaggagtccagcaccactgccactgag
gctgcaggaccgagatctcactcagcagacagcagcagcccgggagcctga

DBGET integrated database retrieval system