KEGG   Homo sapiens (human): 84285
Entry
84285             CDS       T01001                                 

Gene name
EIF1AD, OBELIX, haponin
Definition
(RefSeq) eukaryotic translation initiation factor 1A domain containing
  KO
K15025  probable RNA-binding protein EIF1AD
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99974 Translation
    84285 (EIF1AD)
SSDB
Motif
Pfam: eIF-1a
Other DBs
NCBI-GeneID: 84285
NCBI-ProteinID: NP_001229410
OMIM: 618473
HGNC: 28147
Ensembl: ENSG00000175376
Vega: OTTHUMG00000166671
Pharos: Q8N9N8(Tdark)
UniProt: Q8N9N8 A0A024R5B9
LinkDB
Structure
PDB: 
2DGY

Position
11q13.1
AA seq 165 aa
MSQATKRKHVVKEVLGEHIVPSDQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKN
IWIKRGDFLIVDPIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNNRNRQT
QPELPAEPQLSGEESSSEDDSDLFVNTNRRQYHESEEESEEEEAA
NT seq 498 nt   +upstreamnt  +downstreamnt
atgtctcaggccaccaagaggaagcatgtggtgaaggaggtgctaggggagcacatagtg
ccctccgaccagcagcagattgtcagggtactcaggaccccagggaacaatctgcatgag
gtggagacagcccaagggcagcgcttcctggtgagcatgccctccaaataccgcaagaac
atctggatcaagagaggggactttctcattgttgaccccattgaagagggagaaaaggtg
aaggctgaaatctcgtttgtgctctgcaaggaccacgtgcgctctctgcagaaggagggg
ttttggcctgaggccttctctgaagtggctgagaaacacaacaacaggaacagacaaact
caaccagaactcccagctgagccacagttatcaggagaggagtccagctcagaagatgat
tctgacctgtttgttaacacaaaccgcagacagtatcatgagagtgaggaggagagtgaa
gaggaggaggcagcctga

DBGET integrated database retrieval system