KEGG   Homo sapiens (human): 84307Help
Entry
84307             CDS       T01001                                 

Gene name
ZNF397, ZNF47, ZSCAN15
Definition
(RefSeq) zinc finger protein 397
  KO
K09230  SCAN domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    84307 (ZNF397)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 SCAN zf-C2H2_4 zf-C2H2_6 Zn-ribbon_8 XPA_N zf-C2H2_11 zf-C2H2_jaz zinc_ribbon_15 C1_4 DUF3268 zinc_ribbon_4
Motif
Other DBs
NCBI-GeneID: 84307
NCBI-ProteinID: NP_001128650
OMIM: 609601
HGNC: 18818
Ensembl: ENSG00000186812
Vega: OTTHUMG00000178532
Pharos: Q8NF99(Tdark)
UniProt: Q8NF99
LinkDB All DBs
Position
18q12.2
AA seq 534 aa AA seqDB search
MAVESGVISTLIPQDPPEQELILVKVEDNFSWDEKFKQNGSTQSCQELFRQQFRKFCYQE
TPGPREALSRLQELCYQWLMPELHTKEQILELLVLEQFLSILPEELQIWVQQHNPESGEE
AVTLLEDLEREFDDPGQQVPASPQGPAVPWKDLTCLRASQESTDIHLQPLKTQLKSWKPC
LSPKSDCENSETATKEGISEEKSQGLPQEPSFRGISEHESNLVWKQGSATGEKLRSPSQG
GSFSQVIFTNKSLGKRDLYDEAERCLILTTDSIMCQKVPPEERPYRCDVCGHSFKQHSSL
TQHQRIHTGEKPYKCNQCGKAFSLRSYLIIHQRIHSGEKAYECSECGKAFNQSSALIRHR
KIHTGEKACKCNECGKAFSQSSYLIIHQRIHTGEKPYECNECGKTFSQSSKLIRHQRIHT
GERPYECNECGKAFRQSSELITHQRIHSGEKPYECSECGKAFSLSSNLIRHQRIHSGEEP
YQCNECGKTFKRSSALVQHQRIHSGDEAYICNECGKAFRHRSVLMRHQRVHTIK
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggaatctggagtgatttcaaccctgatacctcaggatcctccggaacaagaa
ctaatactagtgaaagtagaagataacttttcctgggatgagaaatttaagcagaatggg
agtactcaatcctgccaagaattgtttcgtcagcaattcagaaaattttgctaccaggag
acacctgggccccgggaggctctgagccgactccaggaactttgctatcagtggctaatg
ccagagttgcacacaaaggagcagatcttagaactgctggtactggagcagttcctgagc
attctgcctgaggagctgcagatctgggttcagcaacataatccagaaagcggcgaggaa
gctgtgaccctgttggaggatttagagagggagtttgatgacccagggcagcaggtccca
gctagtccacagggaccagcagtgccatggaaggatttaacatgtctcagagcatcccaa
gagtcaacagacatccacctccagcccttaaagacacagctgaaatcctggaaaccatgc
ctttcccctaaaagtgattgtgagaacagtgaaacagcaacaaaagagggcatctcagaa
gaaaaatcacagggactccctcaggaaccttcatttcgaggaattagtgagcatgaaagc
aatttagtgtggaagcaaggaagtgctacaggggagaaactaagatctccttcccaaggg
ggcagttttagtcaagtgatcttcacaaacaaatctctaggaaagagagacctttatgat
gaggctgaaagatgcttgattctaactacagactctataatgtgtcagaaagttcctcca
gaagagagaccttatagatgtgatgtatgtgggcacagcttcaagcagcattcctctcta
acacaacatcagagaatccatactggagaaaagccctataaatgtaaccagtgtgggaag
gcctttagtttgaggtcctatcttattattcatcagagaattcatagtggtgagaaagca
tatgaatgtagtgaatgtgggaaagctttcaatcagagctcagccctcattagacatcgg
aaaatccatactggtgagaaagcttgtaaatgtaatgagtgtggcaaagcattcagtcaa
agttcatatctcattatacatcaaagaattcacactggtgagaaaccttatgagtgtaat
gaatgtgggaaaacctttagccagagctcaaaactcattagacatcagcgaattcacaca
ggagagagaccctatgaatgtaatgaatgtggaaaagctttcaggcagagctcagagctg
attactcatcagagaatacatagtggagagaaaccctatgaatgtagtgaatgtggaaaa
gctttcagtttgagctcaaaccttatcagacatcagagaattcatagtggggaggaacct
tatcagtgtaatgaatgtggcaaaactttcaaaaggagctcagcccttgttcagcatcag
agaattcattctggggatgaagcttatatatgtaatgaatgtgggaaggctttcaggcac
agatcggtccttatgcgccatcaaagagtccacactataaagtaa

DBGET integrated database retrieval system