KEGG   Homo sapiens (human): 84309Help
Entry
84309             CDS       T01001                                 

Gene name
NUDT16L1, SDOS, TIRR
Definition
(RefSeq) nudix hydrolase 16 like 1
  KO
K16867  NUDT16-like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    84309 (NUDT16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 84309
NCBI-ProteinID: NP_115725
OMIM: 617338
HGNC: 28154
Ensembl: ENSG00000168101
Vega: OTTHUMG00000129471
Pharos: Q9BRJ7(Tdark)
UniProt: Q9BRJ7 B2RD96
LinkDB All DBs
Structure
PDB: 

Position
16p13.3
AA seq 211 aa AA seqDB search
MSTAAVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLL
GFPGGFVDRRFWSLEDGLNRVLGLGLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLE
QLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVL
NMMPEEKLVEALAAATEKQKKALEKLLPASS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacggcggcggttccggagctgaagcagatcagccgggtggaggcgatgcgccta
gggccgggctggagccactcgtgccacgccatgctgtacgccgccaaccctgggcagctc
ttcggccgcatccccatgcgcttctcggtgctgatgcagatgcgtttcgacgggctgctg
ggcttccccgggggcttcgtggaccggcgcttctggtcgctggaggacggcctgaaccgg
gtgctgggcctgggcctgggctgcctgcgcctcaccgaggccgactacctgagctcgcac
ctgaccgagggcccacaccgcgtcgtggcgcacctgtacgcgcggcagctgacgctggag
cagctgcacgccgtggagatcagcgcggtgcactcgcgcgaccacggcctggaggtgctg
ggcctcgtgcgggtcccgctgtacacccagaaggaccgagtcggaggcttccccaacttc
ctgagcaacgccttcgtgagcacggctaagtgccagctcctctttgccctcaaggtgctc
aacatgatgcccgaggagaagctggttgaggccctggctgcagccaccgagaagcagaag
aaggccctggagaagttgctcccggcctcctcttga

DBGET integrated database retrieval system