KEGG   Homo sapiens (human): 84335
Entry
84335             CDS       T01001                                 

Gene name
AKT1S1, Lobe, PRAS40
Definition
(RefSeq) AKT1 substrate 1
  KO
K16184  proline-rich AKT1 substrate 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04714  Thermogenesis
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    84335 (AKT1S1)
   04150 mTOR signaling pathway
    84335 (AKT1S1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    84335 (AKT1S1)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    84335 (AKT1S1)
   04213 Longevity regulating pathway - multiple species
    84335 (AKT1S1)
  09159 Environmental adaptation
   04714 Thermogenesis
    84335 (AKT1S1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    84335 (AKT1S1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    84335 (AKT1S1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    84335 (AKT1S1)
SSDB
Motif
Pfam: PRAS Senescence_reg
Other DBs
NCBI-GeneID: 84335
NCBI-ProteinID: NP_001092102
OMIM: 610221
HGNC: 28426
Ensembl: ENSG00000204673
Vega: OTTHUMG00000150246
Pharos: Q96B36(Tchem)
UniProt: Q96B36 A0A024QZF6
LinkDB
Structure
PDB: 
5WBY 5WBU 6SB0

Position
19q13.33
AA seq 256 aa
MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARR
CLHDIALAHRAATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQL
GISDNGGLFVMDEDATLQDLPPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQY
AKSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLP
RPRLNTSDFQKLKRKY
NT seq 771 nt   +upstreamnt  +downstreamnt
atggcgtcggggcgccccgaggagctgtgggaggccgtggtgggggccgctgagcgcttc
cgggcccggactggcacggagctggtgctgctgaccgcggccccgccgccaccaccccgc
ccgggcccctgtgcctatgctgcccatggtcgaggagccctggcggaggcagcgcgccgt
tgcctccacgacatcgcactggcccacagggctgccactgctgctcggcctcctgcgccc
ccaccagcaccacagccacccagtcccacacccagcccaccccggcctaccctggccaga
gaggacaacgaggaggacgaggatgagcccacagagacagagacctccggggagcagctg
ggcattagtgataatggagggctctttgtgatggatgaggacgccaccctccaggacctt
ccccccttctgtgagtcagaccccgagagtacagatgatggcagcctgagcgaggagacc
cccgccggcccccccacctgctcagtgcccccagcctcagccctacccacacagcagtac
gccaagtccctgcctgtgtctgtgcccgtctggggcttcaaggagaagaggacagaggcg
cggtcatcagatgaggagaatgggccgccctcttcgcccgacctggaccgcatcgcggcg
agcatgcgcgcgctggtgctgcgagaggccgaggacacccaggtcttcggggacctgcca
cggccgcggcttaacaccagcgacttccagaagctgaagcggaaatattga

DBGET integrated database retrieval system