KEGG   Homo sapiens (human): 84440Help
Entry
84440             CDS       T01001                                 

Gene name
RAB11FIP4, FIP4-Rab11, RAB11-FIP4
Definition
(RefSeq) RAB11 family interacting protein 4
  KO
K12485  Rab11 family-interacting protein 3/4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    84440 (RAB11FIP4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    84440 (RAB11FIP4)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    84440 (RAB11FIP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RBD-FIP HAP1_N EF-hand_8 Shugoshin_N bZIP_1 bZIP_2 EF-hand_7 EF-hand_9 Leu_zip ZapB VGPC1_C
Motif
Other DBs
NCBI-GeneID: 84440
NCBI-ProteinID: NP_116321
OMIM: 611999
HGNC: 30267
Ensembl: ENSG00000131242
Vega: OTTHUMG00000132787
Pharos: Q86YS3(Tbio)
UniProt: Q86YS3
LinkDB All DBs
Position
17q11.2
AA seq 637 aa AA seqDB search
MAGGAGWSGAPAALLRSVRRLREVFEVCGRDPDGFLRVERVAALGLRFGQGEEVEKLVKY
LDPNDLGRINFKDFCRGVFAMKGCEELLKDVLSVESAGTLPCAPEIPDCVEQGSEVTGPT
FADGELIPREPGFFPEDEEEAMTLAPPEGPQELYTDSPMESTQSLEGSVGSPAEKDGGLG
GLFLPEDKSLVHTPSMTTSDLSTHSTTSLISNEEQFEDYGEGDDVDCAPSSPCPDDETRT
NVYSDLGSSVSSSAGQTPRKMRHVYNSELLDVYCSQCCKKINLLNDLEARLKNLKANSPN
RKISSTAFGRQLMHSSNFSSSNGSTEDLFRDSIDSCDNDITEKVSFLEKKVTELENDSLT
NGDLKSKLKQENTQLVHRVHELEEMVKDQETTAEQALEEEARRHREAYGKLEREKATEVE
LLNARVQQLEEENTELRTTVTRLKSQTEKLDEERQRMSDRLEDTSLRLKDEMDLYKRMMD
KLRQNRLEFQKEREATQELIEDLRKELEHLQMYKLDCERPGRGRSASSGLGEFNARAREV
ELEHEVKRLKQENYKLRDQNDDLNGQILSLSLYEAKNLFAAQTKAQSLAAEIDTASRDEL
MEALKEQEEINFRLRQYMDKIILAILDHNPSILEIKH
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcggcgcgggctggtcgggcgcccccgcggctctgctgcgctccgtgcgccgc
ctgcgcgaggtgttcgaggtgtgcggccgcgaccccgacggcttcctgcgcgtggagcgc
gtcgcggcgctcggactgcgcttcggccagggcgaggaggtggaaaaacttgtgaaatat
ttggatcccaacgacctggggagaatcaacttcaaggacttttgccggggggtgttcgcc
atgaaagggtgcgaggagctgctgaaggatgtgctgtcggtggagagcgcggggacgctg
ccgtgcgcgccagagatcccagactgcgtggagcagggcagcgaggtcacaggccccacc
tttgctgatggcgagctcatccccagggaacccggcttttttcccgaggacgaggaggag
gctatgacgctggcgccacctgagggcccccaggagttgtacacagacagccccatggag
agcactcagagcctggaggggtctgtcgggagtcctgccgagaaggacgggggacttggg
ggcctgtttctgccagaagacaagtccctggtccacactccatccatgacgacctcagac
ctttctacacactccaccacctcgctcatcagcaatgaggagcagtttgaagactatggg
gagggtgacgatgtggactgtgcccccagcagcccttgccccgatgatgagaccaggacc
aacgtctactcggacctggggtcttcggtgtcttccagtgcggggcagacgcctaggaaa
atgcggcacgtgtacaacagcgaattgctagatgtttactgctctcaatgctgcaagaaa
atcaacctgctcaatgacttggaagcccgactgaaaaacctgaaggccaacagccccaac
cgaaagatctccagcacggcctttggacggcagctcatgcacagcagcaacttcagcagc
agcaatggcagcaccgaagacctgttccgggacagcattgactcttgcgacaatgacatc
acagagaaggtaagcttcctggaaaagaaggtgacagagctggagaatgacagcctgacc
aatggggacctgaagagcaagctgaagcaagagaacacacagctggtgcacagggtgcat
gagctggaggagatggtgaaggatcaggagaccacggccgagcaggctctggaggaggag
gcgcggcgccaccgcgaggcctacggcaagctggagagggagaaggctaccgaggtggag
ctgctcaatgccagggtgcagcagttggaggaagaaaatacagagcttagaacaacagtg
actcggctcaagtctcaaacagagaaactggatgaggagcggcagcgcatgtctgaccgt
ctggaggacaccagcctgcggctcaaagatgagatggacctgtacaagcgcatgatggac
aagctgcgacagaaccgccttgagttccagaaggagcgggaggcgacgcaggagctcatc
gaggacttgcggaaggagctggagcacctgcagatgtacaagctggactgcgagcggcca
ggcaggggccgcagtgcctcctctggcctaggcgagttcaatgccagggcccgcgaggtg
gagctcgagcacgaggtcaagcggctcaagcaggagaattataagctgcgggatcagaac
gacgacttgaatgggcagattttgagcctcagcctctacgaagcaaaaaacctctttgct
gcccagactaaagcccagtctctggctgcggagatagacaccgcctcgcgcgatgagcta
atggaagccctgaaggagcaggaggagatcaacttccggctgaggcagtacatggacaag
attatcctcgccatcctggaccacaatccctccatcctcgagatcaaacactaa

KEGG   Homo sapiens (human): 9727Help
Entry
9727              CDS       T01001                                 

Gene name
RAB11FIP3, CART1, FIP3-Rab11, Rab11-FIP3
Definition
(RefSeq) RAB11 family interacting protein 3
  KO
K12485  Rab11 family-interacting protein 3/4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9727 (RAB11FIP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9727 (RAB11FIP3)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    9727 (RAB11FIP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RBD-FIP EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 ZapB WD40_alt EF-hand_5
Motif
Other DBs
NCBI-GeneID: 9727
NCBI-ProteinID: NP_055515
OMIM: 608738
HGNC: 17224
Ensembl: ENSG00000090565
Vega: OTTHUMG00000047843
Pharos: O75154(Tbio)
UniProt: O75154
LinkDB All DBs
Structure
PDB: 

Position
16p13.3
AA seq 756 aa AA seqDB search
MASAPPASPPGSEPPGPDPEPGGPDGPGAAQLAPGPAELRLGAPVGGPDPQSPGLDEPAP
GAAADGGARWSAGPAPGLEGGPRDPGPSAPPPRSGPRGQLASPDAPGPGPRSEAPLPELD
PLFSWTEEPEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGS
PPQPSDLSQTHPLPSEPVGSQEDGPRLRAVFDALDGDGDGFVRIEDFIQFATVYGAEQVK
DLTKYLDPSGLGVISFEDFYQGITAIRNGDPDGQCYGGVASAQDEEPLACPDEFDDFVTY
EANEVTDSAYMGSESTYSECETFTDEDTSTLVHPELQPEGDADSAGGSAVPSECLDAMEE
PDHGALLLLPGRPHPHGQSVITVIGGEEHFEDYGEGSEAELSPETLCNGQLGCSDPAFLT
PSPTKRLSSKKVARYLHQSGALTMEALEDPSPELMEGPEEDIADKVVFLERRVLELEKDT
AATGEQHSRLRQENLQLVHRANALEEQLKEQELRACEMVLEETRRQKELLCKMEREKSIE
IENLQTRLQQLDEENSELRSCTPCLKANIERLEEEKQKLLDEIESLTLRLSEEQENKRRM
GDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLKLEAEQRRGRSSSMGLQEYHSRARE
SELEQEVRRLKQDNRNLKEQNEELNGQIITLSIQGAKSLFSTAFSESLAAEISSVSRDEL
MEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEVK
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggccccgccggcctcgcccccgggctcggagccgccggggcccgacccggag
ccgggcgggccggacgggccgggggcggcacaactggctccgggccctgcggagctacgc
ctcggagcgcccgtcggcggccccgacccgcagtccccgggcctggatgagcctgcgccc
ggggccgctgcagatggcggggcgcgttggagcgccgggccggccccggggctggaggga
ggcccgcgagaccccgggccgtccgccccgccgccgcgctccggcccgcgggggcagctt
gcgagccccgacgccccgggcccagggccgcgctccgaagcgccgcttccagaactcgac
ccgttgttctcctggactgaggagcccgaggagtgtggccccgcgagctgcccggagagc
gcgcctttccgcttgcaggggtccagcagcagccaccgagcgcggggcgaggtcgacgtc
ttctctcccttccccgcgcccacggcgggcgagctggcgctggagcaaggtcccgggtcc
ccgccgcagccctcggacctcagccagacccacccccttccgagcgagcccgtggggagt
caggaggacggcccccgcctccgagccgtgttcgatgccctggacggggatggggacggt
ttcgtccgcatcgaggacttcatccagtttgctacggtctacggggcagagcaggtgaag
gacttaactaagtacttggatcccagtgggctcggcgtgatcagctttgaagacttctac
caagggatcacagccatcagaaacggagatcctgatggccagtgctacggtggtgtcgct
tctgcccaagatgaggagcccctggcctgcccggacgagttcgatgacttcgtcacctat
gaggccaacgaggtgacggacagcgcgtacatgggctccgagagcacctacagtgagtgt
gagaccttcacggacgaggacaccagcaccctggtgcaccctgagctgcaacctgaaggg
gacgcagacagtgccggcggctcggccgtgccctctgagtgcctggacgccatggaggag
cccgaccatggtgccctgctgctgctcccaggcaggcctcacccccatggccagtctgtc
atcacggtgatcgggggcgaggagcactttgaggactacggtgaaggcagtgaggcggag
ctgtccccagagaccctatgcaacgggcagctgggctgcagtgaccccgctttcctcacg
cccagtccgacaaagcggctctccagcaagaaggtggcaaggtacctgcaccagtcaggg
gccctgaccatggaggccctggaggacccttcccccgagctcatggagggcccagaggag
gacattgctgacaaggttgtcttcctggaaaggcgtgtgctggagctggaaaaggacacg
gcagccaccggtgagcaacacagccgcctgaggcaggagaacctgcagctggtgcacaga
gcaaacgccctggaggagcagctgaaggagcaggagctgagagcctgcgagatggtcctg
gaagagacccggcgtcagaaggagctcctgtgcaagatggagagggagaagagcattgag
atcgagaacctgcagaccaggctacagcaactggacgaggagaacagtgaactccggtcc
tgcacgccctgtctgaaggccaacattgagcgtctggaggaggagaagcagaagctgttg
gatgagatagagtcgctgacgctgcggctcagtgaagagcaggagaacaagaggagaatg
ggggacaggctgagtcacgagaggcaccagttccagagggacaaggaggccacccaggag
ctgatcgaggacctccgaaagcagctggagcacctgcagctcctcaagctggaggccgag
cagcggcggggccgcagcagcagcatgggcctgcaggagtaccacagccgcgcccgggag
agcgagctggagcaggaggtccgcaggctgaagcaggacaaccgcaacctgaaggagcag
aacgaggagctgaacgggcagatcattaccctcagcatccagggcgccaagagcctcttc
tccacagccttctctgagtccctggctgcagagatcagctccgtctcccgagatgagctc
atggaggcgattcagaagcaggaggagatcaacttccgcctgcaggactacatcgacagg
atcatcgtggccatcatggagaccaacccgtccatcctggaggtcaagtag

DBGET integrated database retrieval system