KEGG   Homo sapiens (human): 84447Help
Entry
84447             CDS       T01001                                 

Gene name
SYVN1, DER3, HRD1
Definition
(RefSeq) synoviolin 1
  KO
K10601  E3 ubiquitin-protein ligase synoviolin [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    84447 (SYVN1)
   04120 Ubiquitin mediated proteolysis
    84447 (SYVN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    84447 (SYVN1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     84447 (SYVN1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    84447 (SYVN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_2 zf-rbx1 zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-C3HC4_3 Zn_ribbon_17 zf-RING_5 zf-RING_11 Prok-RING_4 FANCL_C zf-ANAPC11 Zf_RING zf-RING-like zf-HC5HC2H zf-C3H2C3 RINGv Endonuclease_7
Motif
Other DBs
NCBI-GeneID: 84447
NCBI-ProteinID: NP_757385
OMIM: 608046
HGNC: 20738
Ensembl: ENSG00000162298
Vega: OTTHUMG00000165607
Pharos: Q86TM6(Tbio)
UniProt: Q86TM6
LinkDB All DBs
Structure
PDB: 

Position
11q13.1
AA seq 617 aa AA seqDB search
MFRTAVMMAASLALTGAVVAHAYYLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKV
MGKVFFGQLRAAEMEHLLERSWYAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLA
EDRVDFMERSPNISWLFHCRIVSLMFLLGILDFLFVSHAYHSILTRGASVQLVFGFEYAI
LMTMVLTIFIKYVLHSVDLQSENPWDNKAVYMLYTELFTGFIKVLLYMAFMTIMIKVHTF
PLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVT
GAKRLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPPPPEPADQGPPPAPHPP
PLLPQPPNFPQGLLPPFPPGMFPLWPPMGPFPPVPPPPSSGEAVAPPSTSAAALSRPSGA
ATTTAAGTSATAASATASGPGSGSAPEAGPAPGFPFPPPWMGMPLPPPFAFPPMPVPPAG
FAGLTPEELRALEGHERQHLEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSV
NSTEETATTVVAAASSTSIPSSEATTPTPGASPPAPEMERPPAPESVGTEEMPEDGEPDA
AELRRRRLQKLESPVAH
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcacggcagtgatgatggcggccagcctggcgctgaccggggctgtggtggct
cacgcctactacctcaaacaccagttctaccccactgtggtgtacctgaccaagtccagc
cccagcatggcagtcctgtacatccaggcctttgtccttgtcttccttctgggcaaggtg
atgggcaaggtgttctttgggcaactgagggcagcagagatggagcaccttctggaacgt
tcctggtacgccgtcacagagacttgtctggccttcaccgtttttcgggatgacttcagc
ccccgctttgttgcactcttcactcttcttctcttcctcaaatgtttccactggctggct
gaggaccgtgtggactttatggaacgcagccccaacatctcctggctctttcactgccgc
attgtctctcttatgttcctcctgggcatcctggacttcctcttcgtcagccacgcctat
cacagcatcctgacccgtggggcctctgtgcagctggtgtttggctttgagtatgccatc
ctgatgacgatggtgctcaccatcttcatcaagtatgtgctgcactccgtggacctccag
agtgagaacccctgggacaacaaggctgtgtacatgctctacacagagctgtttacaggc
ttcatcaaggttctgctgtacatggccttcatgaccatcatgatcaaggtgcacaccttc
ccactctttgccatccggcccatgtacctggccatgagacagttcaagaaagctgtgaca
gatgccatcatgtctcgccgagccatccgcaacatgaacaccctgtatccagatgccacc
ccagaggagctccaggcaatggacaatgtctgcatcatctgccgagaagagatggtgact
ggtgccaagagactgccctgcaaccacattttccataccagctgcctgcgctcctggttc
cagcggcagcagacctgccccacctgccgtatggatgtccttcgtgcatcgctgccagcg
cagtcaccaccacccccggagcctgcggatcaggggccaccccctgccccccacccccca
ccactcttgcctcagccccccaacttcccccagggcctcctgcctccttttcctccaggc
atgttcccactgtggccccccatgggcccctttccacctgtcccgcctccccccagctca
ggagaggctgtggctcctccatccaccagtgcagcagccctttctcggcccagtggagca
gctacaaccacagctgctggcaccagtgctactgctgcttctgccacagcatctggccca
ggctctggctctgccccagaggctggccctgcccctggtttccccttccctcctccctgg
atgggtatgcccctgcctccaccctttgccttccccccaatgcctgtgccccctgcgggc
tttgctgggctgaccccagaggagctacgagctctggagggccatgagcggcagcacctg
gaggcccggctgcagagcctgcgtaacatccacacactgctggacgccgccatgctgcag
atcaaccagtacctcaccgtgctggcctccttggggcccccccggcctgccacttcagtc
aactccactgaggagactgccactacagttgttgctgctgcctcctccaccagcatccct
agctcagaggccacgaccccaaccccaggagcctccccaccagcccctgaaatggaaagg
cctccagctcctgagtcagtgggcacagaggagatgcctgaggatggagagcccgatgca
gcagagctccgccggcgccgcctgcagaagctggagtctcctgttgcccactga

DBGET integrated database retrieval system