KEGG   Homo sapiens (human): 8450
Entry
8450              CDS       T01001                                 

Gene name
CUL4B, CUL-4B, MRXHF2, MRXS15, MRXSC, SFM2
Definition
(RefSeq) cullin 4B
  KO
K10609  cullin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
hsa04120  Ubiquitin mediated proteolysis
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
  Element
N00456  HIV Vpr to CDC25-cell cycle G2M
Disease
H00658  Syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8450 (CUL4B)
  09124 Replication and repair
   03420 Nucleotide excision repair
    8450 (CUL4B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    8450 (CUL4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8450 (CUL4B)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    8450 (CUL4B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8450 (CUL4B)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Cullin
     8450 (CUL4B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      8450 (CUL4B)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      8450 (CUL4B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8450 (CUL4B)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 SecA_SW
Other DBs
NCBI-GeneID: 8450
NCBI-ProteinID: NP_003579
OMIM: 300304
HGNC: 2555
Ensembl: ENSG00000158290
Vega: OTTHUMG00000022302
Pharos: Q13620(Tbio)
UniProt: Q13620
LinkDB
Structure
PDB: 
4A64 4A0C 4A0L 2DO7

Position
Xq24
AA seq 913 aa
MMSQSSGSGDGNDDEATTSKDGGFSSPSPSAAAAAQEVRSATDGNTSTTPPTSAKKRKLN
SSSSSSSNSSNEREDFDSTSSSSSTPPLQPRDSASPSTSSFCLGVSVAASSHVPIQKKLR
FEDTLEFVGFDAKMAEESSSSSSSSSPTAATSQQQQLKNKSILISSVASVHHANGLAKSS
TTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKYNLEEL
YQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQM
IMIRSIFLFLDRTYVLQNSMLPSIWDMGLELFRAHIISDQKVQNKTIDGILLLIERERNG
EAIDRSLLRSLLSMLSDLQIYQDSFEQRFLEETNRLYAAEGQKLMQEREVPEYLHHVNKR
LEEEADRLITYLDQTTQKSLIATVEKQLLGEHLTAILQKGLNNLLDENRIQDLSLLYQLF
SRVRGGVQVLLQQWIEYIKAFGSTIVINPEKDKTMVQELLDFKDKVDHIIDICFLKNEKF
INAMKEAFETFINKRPNKPAELIAKYVDSKLRAGNKEATDEELEKMLDKIMIIFRFIYGK
DVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMI
QFKQYMQNQNVPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRK
LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR
TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE
RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME
RDKENPNQYNYIA
NT seq 2742 nt   +upstreamnt  +downstreamnt
atgatgtcacagtcatctggatcaggagatgggaatgatgatgaggctactacctctaaa
gacggtggtttttcttcccccagtccctcagctgctgctgctgctcaggaggtcagatct
gccactgatggtaataccagcaccactccgcccacctctgccaagaagagaaagttaaac
agcagcagcagtagcagcagtaacagtagtaacgagagagaagactttgattccacctct
tcctcctcttccactcctcctttacaacccagggattcggcatccccttcaacctcgtcc
ttctgcctgggggtttcagtggctgcttccagccacgtaccgatacagaagaagctgcgt
tttgaagacaccctggagtttgtagggtttgatgcgaagatggctgaggaatcctcctcc
tcctcctcctcatcttcaccaactgctgcaacatctcagcagcagcaacttaaaaataag
agtatattaatctcttctgtggcttcggtgcatcatgcaaacggcctagccaaatcttct
accaccgtctctagctttgctaacagcaaacctggctctgctaagaagttagtgatcaag
aactttaaagataagcctaaattaccagaaaactacacagatgaaacctggcaaaaactg
aaagaagcagtggaagctattcagaatagtacttcaattaagtacaatttagaagaactc
taccaggctgtagaaaatctctgttcttacaagatttctgcaaacttgtacaaacagctg
agacagatctgcgaagatcacatcaaagcacagattcatcaattcagagaggattcattg
gatagcgttctttttttaaagaagattgatagatgctggcaaaaccattgcagacaaatg
atcatgatcaggagcatttttttgtttctggatagaacttacgttcttcagaattcaatg
ctaccctccatttgggacatgggactggagttatttagggctcatattataagtgatcag
aaagtgcagaataagacaattgatggcattcttctcttgattgagagggaaaggaatggt
gaagcaattgatagaagtttacttcgaagccttttaagcatgctgtctgatttgcaaatt
tatcaagattcttttgaacaacgatttttggaagaaactaaccggctctatgcagctgaa
ggccaaaaattaatgcaagaaagagaggttcctgaatatctacatcatgttaacaaacgt
ctagaagaagaagcagacagacttattacttacttagatcagaccacccagaagtcatta
attgctactgtagaaaaacaacttctaggtgaacacttaacagcaattcttcagaaaggt
ttaaataacctccttgatgaaaaccgaattcaagatttgtctcttctgtatcagctcttc
agtagagttcgaggtggagttcaggttcttttgcagcagtggatcgaatatatcaaggca
tttggcagcactattgtaattaatcctgaaaaagataaaaccatggttcaagaattgctg
gattttaaagataaggttgaccatataattgatatctgctttctgaagaatgagaaattt
atcaatgccatgaaagaagcatttgaaacgttcattaacaaaagaccaaataaaccagct
gaacttatagctaagtatgtagattcaaaacttcgtgcaggcaacaaagaagctacagat
gaagaacttgagaaaatgttggataaaattatgatcatatttagatttatctatggcaag
gatgtttttgaggccttctataagaaagatttagccaagcgcctgttagtcggaaagagt
gcatctgtagatgctgaaaaatcaatgctgtccaaacttaaacatgaatgcggagctgct
ttcaccagcaaacttgaaggaatgtttaaagacatggaactttctaaagacatcatgatt
cagttcaaacagtatatgcagaatcagaatgttccgggaaatattgagttaactgtgaat
atcctgacaatgggctattggccgacatatgtgcctatggaagttcatttaccaccagag
atggtaaaacttcaggagattttcaagacattttacctaggcaaacatagtggcaggaaa
cttcagtggcagtcaaccctaggacactgtgtgttaaaagcagaatttaaagagggtaaa
aaggaactccaggtctctctttttcaaacactggtgctgctaatgtttaatgagggagag
gagttcagtttagaagagatcaagcaggcaactggaatagaggatggagagttaaggaga
acactgcagtcattagcctgtggcaaagctagagttctggcgaaaaatccaaagggcaaa
gacattgaagatggtgacaagttcatttgtaatgatgatttcaaacataaacttttcagg
ataaagatcaatcaaatccagatgaaagaaacggttgaagaacaagcaagcactacagaa
agagtatttcaagacagacagtatcaaattgatgctgcaattgttcgaattatgaagatg
agaaagacacttagccacaatctccttgtttcagaagtgtacaaccagttgaaatttcca
gtaaagcctgctgatcttaagaagagaatagaatctttaattgaccgggactacatggaa
agagataaagaaaatccaaaccagtacaactatattgcatag

KEGG   Homo sapiens (human): 8451
Entry
8451              CDS       T01001                                 

Gene name
CUL4A
Definition
(RefSeq) cullin 4A
  KO
K10609  cullin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
hsa04120  Ubiquitin mediated proteolysis
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
  Element
N00456  HIV Vpr to CDC25-cell cycle G2M
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8451 (CUL4A)
  09124 Replication and repair
   03420 Nucleotide excision repair
    8451 (CUL4A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    8451 (CUL4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8451 (CUL4A)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    8451 (CUL4A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8451 (CUL4A)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Cullin
     8451 (CUL4A)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      8451 (CUL4A)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      8451 (CUL4A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8451 (CUL4A)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 SecA_SW
Other DBs
NCBI-GeneID: 8451
NCBI-ProteinID: NP_001008895
OMIM: 603137
HGNC: 2554
Ensembl: ENSG00000139842
Vega: OTTHUMG00000017384
Pharos: Q13619(Tbio)
UniProt: Q13619
LinkDB
Structure
PDB: 
2HYE 4A0K

Position
13q34
AA seq 759 aa
MADEAPRKGSFSALVGRTNGLTKPAALAAAPAKPGGAGGSKKLVIKNFRDRPRLPDNYTQ
DTWRKLHEAVRAVQSSTSIRYNLEELYQAVENLCSHKVSPMLYKQLRQACEDHVQAQILP
FREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYVLQNSTLPSIWDMGLELFRT
HIISDKMVQSKTIDGILLLIERERSGEAVDRSLLRSLLGMLSDLQVYKDSFELKFLEETN
CLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDHSTQKPLIACVEKQLLGEHLT
AILQKGLDHLLDENRVPDLAQMYQLFSRVRGGQQALLQHWSEYIKTFGTAIVINPEKDKD
MVQDLLDFKDKVDHVIEVCFQKNERFVNLMKESFETFINKRPNKPAELIAKHVDSKLRAG
NKEATDEELERTLDKIMILFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLK
HECGAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPME
VHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLL
MFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEF
KHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELY
NQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA
NT seq 2280 nt   +upstreamnt  +downstreamnt
atggcggacgaggccccgcggaagggcagcttctcggcgctcgtgggccgcaccaacggc
ctcaccaagcccgcggccctggccgccgcgcccgccaagccggggggcgcgggcggctcc
aagaagctggtcatcaagaacttccgagacagacctcggctgcccgacaactacacgcag
gacacgtggcggaagctgcacgaggcggtgcgggccgtgcagagcagcacctccatcagg
tacaacctcgaggagctctaccaggctgtggaaaatctctgttctcacaaagtctcccca
atgctctacaagcaactgcgtcaggcctgtgaagaccacgtccaggcacagatccttccg
tttagagaagactcactagatagtgttttatttttaaagaagattaacacgtgctggcag
gaccactgcagacaaatgatcatgatcagaagcatcttcctgttcttggaccgcacctat
gtgctgcagaactccacgctgccctccatctgggatatgggattagaactgtttagaacc
catattattagtgataaaatggttcagagtaaaaccattgatggaatcctactgctgatc
gagcgcgagaggagcggcgaggccgtggaccggagcctgttgcggagcctcctgggcatg
ctgtctgacctgcaggtgtataaagattcatttgaactgaaatttttggaagagactaat
tgcttatatgctgccgaaggccaaaggttaatgcaggaaagagaggttccagaatatctt
aaccatgtaagtaaacgcttagaggaagagggagacagagtaatcacttacttggaccac
agcacacagaaaccactgattgcttgtgtggagaaacagctattaggagaacatttaaca
gcaattctgcagaaagggctcgaccacttactggatgagaacagagtgccggacctcgca
cagatgtaccagctgttcagccgggtgaggggcgggcagcaggcgctgctgcagcactgg
agcgagtacatcaagacttttggaacagcgatcgtaatcaatcctgagaaagacaaagac
atggtccaagacctgttggacttcaaggacaaggtggaccacgtgatcgaggtctgcttc
cagaagaatgagcggttcgtcaacctgatgaaggagtcctttgagacgttcatcaacaag
agacccaacaagcctgcagaactgatcgcaaagcatgtggattcaaagttaagagcaggc
aacaaagaagccacagacgaggagctggagcggacgttggacaagatcatgatcctgttc
aggtttatccacggtaaagatgtctttgaagcattttataaaaaagatttggcaaaaaga
ctccttgttgggaaaagtgcctcagtcgatgctgaaaagtctatgttgtcaaagctcaag
catgagtgcggtgcagccttcaccagcaagctggaaggcatgttcaaggacatggagctt
tcgaaggacatcatggttcatttcaagcagcatatgcagaatcagagtgactcaggccct
atagacctcacagtgaacatactcacaatgggctactggccaacatacacgcccatggaa
gtgcacttaaccccagaaatgattaaacttcaggaagtatttaaggcattttatcttgga
aagcacagtggtcgaaaacttcagtggcaaactactttgggacatgctgttttaaaagcg
gagtttaaagaagggaagaaggaattccaggtgtccctcttccagacactggtgctcctc
atgttcaacgagggagatggcttcagctttgaggagataaaaatggccacggggatagag
gatagtgaattgcgcagaacgctgcagtccctggcctgtggcaaagcacgtgtgctgatt
aaaagtcccaaaggaaaggaagtggaagatggagacaagttcatttttaatggagagttc
aagcacaagttgtttagaataaagatcaatcaaattcagatgaaggaaactgttgaggaa
caggttagcaccactgagagagtgtttcaggatagacaatatcagattgatgctgctatc
gtcagaataatgaagatgagaaagactcttggtcataatcttctagtttctgaattatat
aatcagctgaaatttccagtaaagcctggagatttgaaaaagagaattgaatctctgata
gacagagactatatggagagagacaaagacaatccgaatcagtaccactacgtggcctga

DBGET integrated database retrieval system