KEGG   Homo sapiens (human): 8453Help
Entry
8453              CDS       T01001                                 

Gene name
CUL2
Definition
(RefSeq) cullin 2
  KO
K03870  cullin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04066  HIF-1 signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05200  Pathways in cancer
hsa05211  Renal cell carcinoma
Network
nt06225  HIF-1 signaling
nt06264  Renal cell carcinoma
  Element
N00080  Loss of VHL to HIF-1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8453 (CUL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    8453 (CUL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8453 (CUL2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    8453 (CUL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8453 (CUL2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Cullin
     8453 (CUL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cullin Cullin_Nedd8 Rio2_N TFIIE_alpha
Motif
Other DBs
NCBI-GeneID: 8453
NCBI-ProteinID: NP_001185706
OMIM: 603135
HGNC: 2552
Ensembl: ENSG00000108094
Vega: OTTHUMG00000017950
Pharos: Q13617(Tbio)
UniProt: Q13617 A0A140VKB1
LinkDB All DBs
Structure
PDB: 

Position
10p11.21
AA seq 745 aa AA seqDB search
MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTE
TKIFLENHVRHLHKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTE
ADLQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQAILIRMLLREIKNDRGGEDPNQKV
IHGVINSFVHVEQYKKKFPLKFYQEIFESPFLTETGEYYKQEASNLLQESNCSQYMEKVL
GRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMANMYVL
LRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKFVQLINTVLNG
DQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDRLTSFIT
VFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDM
SVSADLNNKFNNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMF
ELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQ
DSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKD
TPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKK
CIEVLIDKQYIERSQASADEYSYVA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgaaaccaagagtagtagattttgatgaaacatggaacaaacttttgacgaca
ataaaagccgtggtcatgttggaatacgtcgaaagagcaacatggaatgaccgtttctca
gatatctatgctttatgtgtggcctatcctgaaccccttggagaaagactttatacagaa
actaagatttttttggaaaatcatgttcggcatttgcataagagagttttggagtcagaa
gaacaagtacttgttatgtatcataggtactgggaagaatacagcaagggtgcagactat
atggactgcttatataggtatctcaacacccagtttattaaaaagaataaattaacagaa
gcggaccttcagtatggctatggtggtgtagatatgaatgaaccacttatggaaatagga
gagctagcattggatatgtggaggaaattgatggttgaaccacttcaggccatccttatc
cgaatgctgctccgagaaatcaaaaatgatcgtggtggagaagacccaaaccagaaagta
atccatggggttattaactcctttgttcatgttgaacagtataagaaaaaattcccctta
aagttttatcaggaaatttttgagtctccctttctgactgaaacaggagagtattacaaa
caagaagcttcaaatttattacaagaatcaaactgctcacagtatatggaaaaggttcta
ggtagattaaaagatgaagaaattcgatgtcgaaaatacctacatccaagttcatatact
aaggtgattcatgaatgtcaacaacgaatggtagcagaccacttacagtttttacatgca
gaatgtcataatataattcgacaagagaaaaaaaatgacatggcaaatatgtacgtctta
ctccgtgctgtgtccactggtttacctcatatgattcaggagctgcaaaaccacatccat
gatgagggccttcgagcaaccagcaaccttactcaggaaaacatgccaacactatttgtg
gagtcagttttggaagtgcatggtaaatttgttcagcttatcaacactgttttgaatggt
gatcagcattttatgagtgcgttggataaggcccttacgtcagttgtaaattacagagaa
cctaagtctgtttgcaaagcacctgaactgcttgctaagtactgtgacaacttactgaag
aagtcagcgaaagggatgacagagaatgaagtggaagacaggctcacgagcttcatcaca
gtgttcaaatacattgatgacaaggacgtctttcaaaagttctacgcaagaatgctggca
aaacgtttaattcatgggttatccatgtctatggactctgaagaagccatgatcaacaaa
ttaaagcaagcctgtggttatgagtttaccagcaagctacatcggatgtatacagatatg
agtgtcagcgctgatctcaacaataagttcaacaattttatcaaaaaccaagacacagta
atagatttgggaattagttttcaaatatatgttctacaggctggtgcgtggcctcttact
caggctccttcatctacgtttgcaattccccaggaattagaaaaaagtgtacagatgttt
gaattattttatagccaacatttcagtggaaggaaacttacatggttacattatctgtgt
acaggtgaagttaaaatgaactatttgggcaaaccatatgtagccatggttacaacatac
caaatggcagttcttcttgcctttaacaacagtgaaactgtcagttataaagagcttcag
gacagcactcagatgaatgaaaaggaactgacaaaaacaatcaaatcattacttgatgtg
aaaatgattaaccatgattcagaaaaggaagatattgatgcagaatcttcgttttcatta
aatatgaactttagcagtaaaagaacaaaatttaaaattactacatcaatgcagaaagac
acaccacaagaaatggagcagactagaagtgcagttgatgaggaccggaaaatgtatctc
caagctgctatagttcgtatcatgaaagcacgaaaagtgcttcggcacaatgcccttatt
caagaggtgattagccagtcaagagctaggtttaatcccagtatcagcatgattaagaag
tgtattgaagttctgatagacaaacaatacatagaacgcagccaggcgtcggcagatgaa
tacagctacgtcgcgtga

DBGET integrated database retrieval system